Property Summary

NCBI Gene PubMed Count 17
PubMed Score 108.30
PubTator Score 23.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.2e-11
medulloblastoma, large-cell 6241 7.8e-04
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 2.0
Disease Target Count Z-score Confidence
Bacterial conjunctivitis 10 4.063 2.0
Atrichia with papular lesions 9 3.452 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 7.8e-04
ovarian cancer 1.100 2.2e-11

 MGI Phenotype (1)

Gene RIF (3)

AA Sequence

MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR      1 - 70
AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL     71 - 140
AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL        141 - 206
//

Text Mined References (19)

PMID Year Title