Property Summary

NCBI Gene PubMed Count 17
PubMed Score 83.08
PubTator Score 23.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 2.2e-11
medulloblastoma, large-cell 6234 7.8e-04
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Bacterial conjunctivitis 10 4.136 2.1
Myxedema 8 3.086 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 7.8e-04
ovarian cancer 1.100 2.2e-11

Gene RIF (3)

PMID Text
25554682 The results suggest that MXD3 is important for survival of Reh preB ALL cells, possibly as an anti-apoptotic factor.
25053245 Acute MXD3 activation results in a transient increase in DAOY cell proliferation while persistent activation of MXD3 results in an overall decrease in cell number, suggesting that the time course of MXD3 expression dictates the cellular outcome.
22808009 Increased level and/or duration of MXD3 expression ultimately reduces cell numbers via increased cell death and cell cycle arrest in medulloblastoma cells.

AA Sequence

MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR      1 - 70
AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL     71 - 140
AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL        141 - 206
//

Text Mined References (19)

PMID Year Title
25554682 2015 Loss of MXD3 induces apoptosis of Reh human precursor B acute lymphoblastic leukemia cells.
25416956 2014 A proteome-scale map of the human interactome network.
25053245 2014 MXD3 regulation of DAOY cell proliferation dictated by time course of activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22808009 2012 Role of MXD3 in proliferation of DAOY human medulloblastoma cells.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
18235219 2008 From cerebellar proliferation to tumorigenesis: new insights into the role of Mad3.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17893326 2007 A novel role of the Mad family member Mad3 in cerebellar granule neuron precursor proliferation.
16908182 2006 The MAX-interacting transcription factor network.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9506959 1998 Identification and characterization of specific DNA-binding complexes containing members of the Myc/Max/Mad network of transcriptional regulators.
8521822 1995 Mad3 and Mad4: novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.