Property Summary

NCBI Gene PubMed Count 42
PubMed Score 13.30
PubTator Score 67.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Rheumatoid Arthritis 1.900 1.5e-02
gastric cancer -1.500 3.6e-04
hepatocellular carcinoma -1.600 5.3e-06
pancreatic cancer 2.800 7.8e-03
esophageal adenocarcinoma -2.400 2.6e-02
psoriasis 2.500 8.1e-48
osteosarcoma -3.009 1.4e-04
posterior fossa group B ependymoma -1.800 2.1e-08
atypical teratoid / rhabdoid tumor -1.500 5.9e-07
glioblastoma -1.100 1.3e-04
medulloblastoma, large-cell -1.300 1.7e-04
primary pancreatic ductal adenocarcinoma 2.873 3.8e-03
tuberculosis and treatment for 3 months -2.000 7.2e-05
intraductal papillary-mucinous adenoma (... 1.800 4.2e-04
intraductal papillary-mucinous carcinoma... 2.500 4.6e-04
intraductal papillary-mucinous neoplasm ... 2.700 1.3e-03
lung cancer -1.400 2.0e-04
diabetes mellitus -1.200 1.6e-02
Breast cancer 2.700 3.3e-02
interstitial cystitis 1.100 5.8e-03
cystic fibrosis 1.200 1.9e-04
pancreatic carcinoma -1.200 4.0e-03
subependymal giant cell astrocytoma -1.101 1.8e-02
nasopharyngeal carcinoma -1.300 2.4e-02
spina bifida -1.689 3.3e-02
invasive ductal carcinoma 1.100 2.5e-02
ovarian cancer -1.500 7.8e-07
axial spondyloarthropathy 1.500 1.4e-03

Protein-protein Interaction (9)

Gene RIF (19)

PMID Text
25611699 down regulation of miR-202 increased the expression of its target Mxd1, followed by Mxd1 recruitment to the Sin3A repressor complex and through its dimerization with Max, and increased repression of Myc-Max target proteins.
24954085 This study suggests that genetic variants of MXD1 may modulate the effect of smoking on carotid plaque burden.
24675462 miR-17-92 cluster members miR-19a/b facilitated gastric cancer cell migration, invasion and metastasis through targeting the antagonist of c-Myc -- MXD1.
19766114 TGF-beta can override Myc activity despite a stabilizing cancer mutation and induce senescence in myeloid tumor cells, at least in part by induction of Mad1
19526459 results suggest that phosphorylation of MAD1 by AKT inhibits MAD1-mediated transcription suppression and subsequently activates the transcription of MAD1 target genes
18457265 Missense mutations in Mad1, Mxi1 and Rox were found in acute leukemia patients.
18451027 This study provides a direct link between the growth factor signaling pathways regulated by PI3 kinase/Akt and MAP kinases with Myc-mediated transcription.
18203738 Results suggest STAT3 functions as a C/EBPbeta cofactor in the regulation of the MAD1 gene.
18155722 Mxd1 D112a and Max N78a and H81d, which are located in the leucine zippers of the proteins, can dictate the specificity of heterodimerization and whether or not the Mxd1/Max/DNA complex forms.
17998413 The PTEN tumor suppressor gene is a target of MAD1.
17577784 Mad1, Mxi1 and Rox genes were expressed and displayed mutations in haematological malignancies.
17082780 Max as a novel co-activator of C/EBPalpha functions, thereby suggesting a possible link between C/EBPalpha and Myc-Max-Mad network.
15645079 c-myc and mad1 can regulate the hTERT transcript in a different manner in hTERT positive cells, but not in normal cells
15282543 MAD1 and Proto-Oncogene Proteins c-myc reciprocally regulate ribosomal DNA transcription, providing a mechanism for coordination of ribosome biogenesis and cell growth
15235594 HBP1 and Mad1 repressors bind the Sin3 corepressor PAH2 domain with opposite helical orientations
12824180 Mad expression and Id2 down-regulation are important events during the TGF-beta cytostatic program in epithelial cells.
12553908 X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors.
12538578 examination of functionality of basic domains compared with Myc
12366697 Mad1 gene transfer inhibits the proliferation of human melanoma cells

AA Sequence

MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRA      1 - 70
HLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIER     71 - 140
IRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIK    141 - 210
LQDSHKACLGL                                                               211 - 221
//

Text Mined References (44)

PMID Year Title
25611699 2015 Down regulation of miR-202 modulates Mxd1 and Sin3A repressor complexes to induce apoptosis of pancreatic cancer cells.
24954085 2014 Novel genetic variants modify the effect of smoking on carotid plaque burden in Hispanics.
24675462 2014 MiR-19a/b modulate the metastasis of gastric cancer cells by targeting the tumour suppressor MXD1.
19766114 2009 TGF-beta enforces senescence in Myc-transformed hematopoietic tumor cells through induction of Mad1 and repression of Myc activity.
19762557 2010 Chromatin remodeling: recruitment of histone demethylase RBP2 by Mad1 for transcriptional repression of a Myc target gene, telomerase reverse transcriptase.
19526459 2009 The suppression of MAD1 by AKT-mediated phosphorylation activates MAD1 target genes transcription.
18457265 2007 [Expression and mutation of myc antagonist genes Mad1, Mxi1 and Rox in leukemia cells].
18451027 2008 Activation of PI3K/Akt and MAPK pathways regulates Myc-mediated transcription by phosphorylating and promoting the degradation of Mad1.
18203738 2008 Regulation of the MAD1 promoter by G-CSF.
18155722 2008 Elucidation of the structural determinants responsible for the specific formation of heterodimeric Mxd1/Max b-HLH-LZ and its binding to E-box sequences.
18082613 2007 c-IAP1 cooperates with Myc by acting as a ubiquitin ligase for Mad1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998413 2008 Inhibition of apoptosis by MAD1 is mediated by repression of the PTEN tumor suppressor gene.
17577784 2007 Expression and mutation analysis of genes that encode the Myc antagonists Mad1, Mxi1 and Rox in acute leukaemia.
17418410 2007 HIF-2alpha promotes hypoxic cell proliferation by enhancing c-myc transcriptional activity.
17082780 2006 Proteomic discovery of Max as a novel interacting partner of C/EBPalpha: a Myc/Max/Mad link.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15645079 2005 Transcript regulation of human telomerase reverse transcriptase by c-myc and mad1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282543 2004 MAD1 and c-MYC regulate UBF and rDNA transcription during granulocyte differentiation.
15235594 2004 HBP1 and Mad1 repressors bind the Sin3 corepressor PAH2 domain with opposite helical orientations.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837246 2003 Multiple tumor suppressor pathways negatively regulate telomerase.
12824180 2003 Mad upregulation and Id2 repression accompany transforming growth factor (TGF)-beta-mediated epithelial cell growth suppression.
12553908 2003 X-ray structures of Myc-Max and Mad-Max recognizing DNA. Molecular bases of regulation by proto-oncogenic transcription factors.
12538578 2003 The Mad and Myc basic domains are functionally equivalent.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12366697 2002 Effect of the transcriptional repressor Mad1 on proliferation of human melanoma cells.
11602341 2001 Function and regulation of the transcription factors of the Myc/Max/Mad network.
11430826 2001 Role of PML and PML-RARalpha in Mad-mediated transcriptional repression.
11370785 2001 Sequence-specific assignment of the PAH2 domain of Sin3B free and bound to Mad1.
11106735 2000 Solution structure of the interacting domains of the Mad-Sin3 complex: implications for recruitment of a chromatin-modifying complex.
11101889 2000 The Mad1-Sin3B interaction involves a novel helical fold.
11031250 2000 The Myc/Max/Mad network and the transcriptional control of cell behavior.
10723141 2000 Identification of Mad as a repressor of the human telomerase (hTERT) gene.
10593926 1999 Mlx, a novel Max-like BHLHZip protein that interacts with the Max network of transcription factors.
10229200 1999 Differential effects of the widely expressed dMax splice variant of Max on E-box vs initiator element-mediated regulation by c-Myc.
9528857 1998 Mmip1: a novel leucine zipper protein that reverses the suppressive effects of Mad family members on c-myc.
9150134 1997 Histone deacetylases associated with the mSin3 corepressor mediate mad transcriptional repression.
9150133 1997 Histone deacetylase activity is required for full transcriptional repression by mSin3A.
8425218 1993 Mad: a heterodimeric partner for Max that antagonizes Myc transcriptional activity.
8290278 1994 Mapping of two genes encoding members of a distinct subfamily of MAX interacting proteins: MAD to human chromosome 2 and mouse chromosome 6, and MXI1 to human chromosome 10 and mouse chromosome 19.
7889570 1995 Mad-Max transcriptional repression is mediated by ternary complex formation with mammalian homologs of yeast repressor Sin3.
7829091 1994 Assignment of the human MAD and MXI1 genes to chromosomes 2p12-p13 and 10q24-q25.