Property Summary

NCBI Gene PubMed Count 46
PubMed Score 13.96
PubTator Score 67.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 5.9e-07
axial spondyloarthropathy 1.500 1.4e-03
Breast cancer 2.700 3.3e-02
cystic fibrosis 1.200 1.9e-04
diabetes mellitus -1.200 1.6e-02
ependymoma -1.300 1.1e-05
esophageal adenocarcinoma -2.400 2.6e-02
gastric cancer -1.500 3.6e-04
glioblastoma -1.100 1.3e-04
hepatocellular carcinoma -1.600 5.3e-06
interstitial cystitis 1.100 5.8e-03
intraductal papillary-mucinous adenoma (... 1.800 4.2e-04
intraductal papillary-mucinous carcinoma... 2.500 4.6e-04
intraductal papillary-mucinous neoplasm ... 2.600 1.3e-03
invasive ductal carcinoma 1.100 2.5e-02
lung cancer -1.400 2.0e-04
medulloblastoma, large-cell -1.300 1.7e-04
nasopharyngeal carcinoma -1.300 2.4e-02
osteosarcoma -3.009 1.4e-04
ovarian cancer -1.500 7.8e-07
pancreatic cancer -1.200 4.0e-03
pancreatic carcinoma -1.200 4.0e-03
pancreatic ductal adenocarcinoma liver m... 1.204 4.5e-03
psoriasis 1.500 1.2e-08
Rheumatoid arthritis 1.900 1.5e-02
spina bifida -1.689 3.3e-02
subependymal giant cell astrocytoma -1.101 1.8e-02
tuberculosis -1.500 2.9e-03

Protein-protein Interaction (9)

Gene RIF (22)

AA Sequence

MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRA      1 - 70
HLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIER     71 - 140
IRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIK    141 - 210
LQDSHKACLGL                                                               211 - 221
//

Text Mined References (48)

PMID Year Title