Property Summary

NCBI Gene PubMed Count 12
PubMed Score 51.70
PubTator Score 3.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma 1.300 1.4e-02
astrocytoma 1.300 4.3e-25
glioblastoma 1.800 2.5e-08
posterior fossa group A ependymoma 1.700 1.1e-13
sonic hedgehog group medulloblastoma 1.900 1.5e-08
atypical teratoid / rhabdoid tumor 1.500 3.0e-07
primitive neuroectodermal tumor 1.300 6.2e-05
tuberculosis 1.200 1.4e-06
pediatric high grade glioma 1.700 2.0e-09
pilocytic astrocytoma 1.500 1.9e-09
subependymal giant cell astrocytoma 1.258 1.6e-02
ovarian cancer 1.700 3.0e-04

Gene RIF (3)

PMID Text
20654576 These results suggest that the expression of MVB12B may be normally suppressed through the ubiquitin-proteasome pathway that simultaneously regulates the fate of MVB12A and the functions of ESCRT-I.
18005716 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
16895919 CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP

AA Sequence

MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVV      1 - 70
ADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDM     71 - 140
GGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLY    141 - 210
GISAMDGVPFTLHPRFEGKSCSPLAFSAFGDLTIKSLADIEEEYNYGFVVEKTAAARLPPSVS           211 - 273
//

Text Mined References (20)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16895919 2006 CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.