Property Summary

NCBI Gene PubMed Count 12
PubMed Score 54.05
PubTator Score 3.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 8.7e-05
astrocytoma 1.300 4.3e-25
Astrocytoma, Pilocytic 1.500 2.7e-09
atypical teratoid / rhabdoid tumor 1.500 3.0e-07
ependymoma 1.600 4.2e-14
glioblastoma 1.800 2.5e-08
group 3 medulloblastoma 1.100 4.1e-04
oligodendroglioma 1.300 1.4e-02
ovarian cancer 1.700 3.0e-04
primitive neuroectodermal tumor 1.300 6.2e-05
subependymal giant cell astrocytoma 1.258 1.6e-02
tuberculosis 1.200 1.4e-06

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVV      1 - 70
ADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDM     71 - 140
GGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLY    141 - 210
GISAMDGVPFTLHPRFEGKSCSPLAFSAFGDLTIKSLADIEEEYNYGFVVEKTAAARLPPSVS           211 - 273
//

Text Mined References (20)

PMID Year Title