Property Summary

NCBI Gene PubMed Count 53
PubMed Score 171.12
PubTator Score 203.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (6)

Gene RIF (47)

PMID Text
25298197 In ovarian mucinous tumors, MUC6 expression changes with the progression of benign to borderline and malignant tumours
25124036 Human TTF2 is a lectin that binds alpha-GlcNAc-capped mucin 6 g with antibiotic activity against Helicobacter pylori.
24901817 There was no difference in the expression of deep MUC1, MUC2, MUC5AC, or MUC6 between the groups of gastric cancer and controls.
24840470 The expression of a subset of mucins (MUC2, MUC6, MUC5B) was also correlated with sialyl-Tn expression in LS174T cells.
24603585 CDX2, MUC1, MUC5AC, and MUC6 expression patterns may provide better estimations of survival after surgical resection of small intestinal adenocarcinoma.
23828549 High MUC6 expression is associated with gastric carcinoma.
23807779 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas
23446997 Data indicate that MUC1 and MUC4 were differentially glycosylated as the disease progressed, and the expression of MUC6 in acinar cells.
23305535 Secretory carcinomas of breast show a unique pattern of strong MUC2, MUC6, and MUC 4 expression.
23163606 Overexpression of EZH2 may be associated with malignant behaviour in intraductal papillary neoplasm of the bile duct in parallel with up-regulated MUC1 expression and down-regulated MUC6 expression.
23054008 A significant association between short rare MUC6-MS5 alleles (7, 9 repeats) and the occurrence of rectal cancer.
22402132 No significant association was found with variants in the MUC6 gene and evolution of gastric cancer precursor lesions.
22261707 Report Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology and roles in neoplastic progression.
21851820 results suggest that MUC6 may inhibit invasion of tumor cells through the basement membrane of the pancreatic duct and slow the development of infiltrating carcinoma.
21596555 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21490447 use of MUC6 to differentiate hyperplastic polyps from sessile serrated adenoma/polyps (SSA/P) or SSA/P with dysplasia in individual cases is not reliable because of a lack of specificity.
21193402 Tn glycosylation of the MUC6 protein modulates its immunogenicity and promotes the induction of Th17-biased T cell responses.
20929551 MUC1, MUC2, MUC5AC, and MUC6 may have a role in malignant transformation and invasion to mucosa or the muscularis mucosae in colorectal polyps
20878553 It is concluded that the expression pattern of secreted mucins including MUC2 and MUC6 is altered in gastric carcinoma.
20602200 Positive immunoreactivity for MUC6 appears to be a complementary marker for malignant transformation of gastric epithelial neoplasia
20506113 The short rare MUC6-minisatellite5 alleles may be related to cancer development by the regulation of MUC6 expression.
20506113 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20139757 Expression of MUC6 in oncocytic/pancreatobiliary-type neoplasms but not in villous/intestinal-type neoplasms supports the presence of a pyloropancreatic pathway distinct from the MUC2/CDX2 expressing intestinal pathway in intraductal papillary neoplasia.
19924550 Observational study of gene-disease association. (HuGE Navigator)
19855374 MUC6 expression is strongly associated with proximal location of serrated polyps, but only has modest utility as a tissue biomarker for sessile serrated adenoma.
19682628 Mucin 6 in seminal plasma may therefore interfere with the sexual transmission of HIV-1 by binding to DC-SIGN.
19423540 Observational study of gene-disease association. (HuGE Navigator)
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
18825309 rates of positivity for E-cadherin and beta-catenin membranous expression patterns and mucin (MUC2, MUC5AC and MUC6) positivity were higher in the young group (P<0.01)than in old patients with gastric carcinoma
18360351 MUC6 was found to have 100% specificity in distinguishing sessile serrated adenoma from hyperplastic polyp
18300795 Report MUC6 expression/pathological features of adenomatous and foveolar gastric epithelial dysplasia.
17982272 The TFF1-GKN2 heterodimer and TFF2 differ characteristically by their binding to gastric mucins.
17471237 this study demonstrates the important role for methylation and/or histone modifications in regulating the 11p15 mucin genes in epithelial cancer cells.
17401217 Downregulation of MUC6 is associated with disease progression to adenocarcinoma of the esophagus
17227128 Expressions of membrane (MUC1) and secreted (MUC5AC, MUC6) mucins are frequently modified in reactive gastropathy.
17009402 Observational study of gene-disease association. (HuGE Navigator)
17009402 Short MUC6 alleles are associated with H pylori infection.
16807756 Down-regulation of MUC6 may contribute to malignant transformation of gastric epithelial cells and underlie the molecular bases of growth, invasion, metastasis and differentiation of gastric carcinoma.
16475027 Overexpresssed in the progression and lymphatic metastasis of prostate cancer.
16447040 MUC6-positive tumours were significantly associated with higher frequencies of the gains of 20q13.2, compared with MUC6-negative tumours (71.4 vs 30.0%, P=0.0349).
15979574 Our results suggest that MUC6 transcription is regulated by NFkappaB and Sp family members.
15716126 Data suggest that MUC6 is expressed in tissues other than stomach and pancreas and that the tandem repeat shows greater variation that previously reported.
15081123 complete genomic (exon/intron) organization
12360467 Aberrant expression of MUC5AC and MUC6 gastric mucins and sialyl Tn antigen in intraepithelial neoplasms of the pancreas.
11988092 Gastric MUC5AC and MUC6 are large oligomeric mucins that differ in size, glycosylation and tissue distribution

AA Sequence

MVQRWLLLSCCGALLSAGLANTSYTSPGLQRLKDSPQTAPDKGQCSTWGAGHFSTFDHHVYDFSGTCNYI      1 - 70
FAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEAIISVKDIGVISLPYTSNGLQITPFGQSVR     71 - 140
LVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFDGKVTNEFVSEEGKFLEPHKFAALQKLDDPG    141 - 210
EICTFQDIPSTHVRQAQHARICTQLLTLVAPECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQ    211 - 280
CSMVGQPVRRWRSPGLCSVGQCPANQVYQECGSACVKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHT    281 - 350
CVPVTQCPCVLHGAMYAPGEVTIAACQTCRCTLGRWVCTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT    351 - 420
YILLQSPQLPEDGALMAVYDKSGVSHSETSLVAVVYLSRQDKIVISQDEVVTNNGEAKWLPYKTRNITVF    421 - 490
RQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDTTDDFTTSMGIAEGTASLFVD    491 - 560
SWRAGNCPAALERETDPCSMSQLNKVCAETHCSMLLRTGTVFERCHATVNPAPFYKRCVYQACNYEETFP    561 - 630
HICAALGDYVHACSLRGVLLWGWRSSVDNCTIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDG    631 - 700
CNCPDGTYLNQKGECVRKAQCPCILEGYKFILAEQSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTF    701 - 770
KSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGVSYPGGA    771 - 840
ELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCGVNDSQPTFKI    841 - 910
LTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLGVTPGALSLVVDISIPGRYNLTLIW    911 - 980
NRHMTILIRIARASQDPLCGLCGNFNGNMKDDFETRSRYVASSELELVNSWKESPLCGDVSFVTDPCSLN    981 - 1050
AFRRSWAERKCSVINSQTFATCHSKVYHLPYYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVD   1051 - 1120
WRTPAFCPIYCGFYNTHTQDGHGEYQYTQEANCTWHYQPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEE   1121 - 1190
GVCVPCMPPTTPQPPTTPQLPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLT   1191 - 1260
SSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMT   1261 - 1330
LPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQPTRPTATETTQTRTTTEYTTP   1331 - 1400
QTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQM   1401 - 1470
ATSASNHSAPTGTIPPPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTPT   1471 - 1540
STTTITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQT   1541 - 1610
TLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHTAPTMTLTTSGTSQ   1611 - 1680
ALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSFSTAKTSTSLH   1681 - 1750
SHTSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSF   1751 - 1820
QTTTTYPTPSHPHTTLPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGSTH   1821 - 1890
TAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTTSASSS   1891 - 1960
RLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIITTHT   1961 - 2030
QMATSASIHSTPTGTVPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSS   2031 - 2100
RPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPV   2101 - 2170
HSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVSPTPSSH   2171 - 2240
LASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTSGVTGIPTSPVTNLTTRHPGP   2241 - 2310
TLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAA   2311 - 2380
SFNIITQQVDARCSCCRPLHSYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACGD              2381 - 2439
//

Text Mined References (53)

PMID Year Title
25298197 2015 Expression profile of mucins (MUC1, MUC2, MUC5AC, and MUC6) in ovarian mucinous tumours: changes in expression from benign to malignant tumours.
25124036 2014 Human trefoil factor 2 is a lectin that binds ?-GlcNAc-capped mucin glycans with antibiotic activity against Helicobacter pylori.
24901817 2014 Gastric mucin expression in first-degree relatives of gastric cancer patients.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
24603585 2014 Prognostic significance of CDX2 and mucin expression in small intestinal adenocarcinoma.
23828549 2014 Mucin phenotype expression of gastric neuroendocrine neoplasms: analysis of histopathology and carcinogenesis.
23807779 2013 Expression of MUC2, MUC5AC, MUC5B, and MUC6 mucins in colorectal cancers and their association with the CpG island methylator phenotype.
23446997 2013 Aberrant expression of mucin core proteins and o-linked glycans associated with progression of pancreatic cancer.
23305535 Secretory carcinoma of breast: pattern of MUC 2/MUC 4/MUC 6 expression.
23163606 2013 Overexpression of enhancer of zeste homolog 2 and MUC1 may be related to malignant behaviour in intraductal papillary neoplasm of the bile duct.
23054008 2013 Association of MUC6-minisatellite variants with susceptibility to rectal carcinoma.
22402132 2012 Genetic variation in MUC1, MUC2 and MUC6 genes and evolution of gastric cancer precursor lesions in a long-term follow-up in a high-risk area in Spain.
22261707 2012 Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology: is this evidence of distinct gastric and intestinal pathways to carcinogenesis in Barrett Esophagus?
21851820 2011 MUC6 mucin expression inhibits tumor cell invasion.
21596555 2012 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21490447 2011 MUC expression in hyperplastic and serrated colonic polyps: lack of specificity of MUC6.
21193402 2011 Tn glycosylation of the MUC6 protein modulates its immunogenicity and promotes the induction of Th17-biased T cell responses.
20929551 2010 Mucins in neoplastic spectrum of colorectal polyps: can they provide predictions?
20878553 2011 MUC2 and MUC6 apomucins expression in human gastric neoplasm: an immunohistochemical analysis.
20602200 2010 Risk factors in malignant transformation of gastric epithelial neoplasia categorized by the revised Vienna classification: endoscopic, pathological, and immunophenotypic features.
20506113 2010 Short rare MUC6 minisatellites-5 alleles influence susceptibility to gastric carcinoma by regulating gene.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20139757 2010 Preferential expression of MUC6 in oncocytic and pancreatobiliary types of intraductal papillary neoplasms highlights a pyloropancreatic pathway, distinct from the intestinal pathway, in pancreatic carcinogenesis.
19924550 2010 A comprehensive analysis of common genetic variation in MUC1, MUC5AC, MUC6 genes and risk of stomach cancer.
19855374 2010 Expression of gastric pyloric mucin, MUC6, in colorectal serrated polyps.
19682628 2009 Mucin 6 in seminal plasma binds DC-SIGN and potently blocks dendritic cell mediated transfer of HIV-1 to CD4(+) T-lymphocytes.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18825309 2008 Cadherin-catenin adhesion system and mucin expression: a comparison between young and older patients with gastric carcinoma.
18360351 2008 Selective expression of gastric mucin MUC6 in colonic sessile serrated adenoma but not in hyperplastic polyp aids in morphological diagnosis of serrated polyps.
18300795 2008 Adenomatous and foveolar gastric dysplasia: distinct patterns of mucin expression and background intestinal metaplasia.
17982272 2007 Biosynthesis of gastrokine-2 in the human gastric mucosa: restricted spatial expression along the antral gland axis and differential interaction with TFF1, TFF2 and mucins.
17471237 2007 Epigenetic regulation (DNA methylation, histone modifications) of the 11p15 mucin genes (MUC2, MUC5AC, MUC5B, MUC6) in epithelial cancer cells.
17401217 Mucin expression profile in Barrett's, dysplasia, adenocarcinoma sequence in the esophagus.
17227128 2007 Mucin expression in reactive gastropathy: an immunohistochemical analysis.
17009402 2006 Short mucin 6 alleles are associated with H pylori infection.
16807756 2006 MUC6 down-regulation correlates with gastric carcinoma progression and a poor prognosis: an immunohistochemical study with tissue microarrays.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16475027 2005 MUC1, MUC2, MUC4, MUC5AC and MUC6 expression in the progression of prostate cancer.
16447040 2006 Gastric and intestinal phenotypic cell marker expressions in gastric differentiated-type carcinomas: association with E-cadherin expression and chromosomal changes.
15979574 2005 Upregulation of MUC6 mucin gene expression by NFkappaB and Sp factors.
15716126 2005 Evaluation of MUC6 mucin tandem repeats.
15280409 2004 Aberrant epithelial expression of trefoil family factor 2 and mucin 6 in Helicobacter pylori infected gastric antrum, incisura, and body and its association with antralisation.
15081123 2004 The complete genomic organization of the human MUC6 and MUC2 mucin genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12360467 2002 Aberrant expression of MUC5AC and MUC6 gastric mucins and sialyl Tn antigen in intraepithelial neoplasms of the pancreas.
11988092 2002 Gastric MUC5AC and MUC6 are large oligomeric mucins that differ in size, glycosylation and tissue distribution.
10330458 1999 Expression of the MUC 6 mucin gene in development of the human kidney and male genital ducts.
10209489 1998 The MUC6 secretory mucin gene is expressed in a wide variety of epithelial tissues.
9422745 1998 Human mucin genes MUC2, MUC3, MUC4, MUC5AC, MUC5B, and MUC6 express stable and extremely large mRNAs and exhibit a variable length polymorphism. An improved method to analyze large mRNAs.
9195947 1997 The carboxyl-terminal sequence of the human secretory mucin, MUC6. Analysis Of the primary amino acid sequence.
7680650 1993 Human gastric mucin. Identification of a unique species by expression cloning.