Property Summary

NCBI Gene PubMed Count 124
PubMed Score 1495.30
PubTator Score 495.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.300 1.8e-02
colon cancer -3.100 5.1e-03
lung cancer -1.900 2.8e-05
pancreatic cancer 1.700 1.3e-03
lung adenocarcinoma 2.100 4.0e-06
breast carcinoma 1.400 1.0e-14
ulcerative colitis 1.800 3.4e-04

Gene RIF (95)

PMID Text
26871673 The variant allele of a common MUC5B promoter variant, rs35705950, is significantly associated with both familial and sporadic idiopathic pulmonary fibrosis. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201509-1872LE#.V2WBpNLrtNs
26871672 Overexpression of MUC5B has been described in idiopathic pulmonary fibrosis lungs. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201507-1322LE#.V2WAGNLrtNs
26823827 the MUC5B polymorphism rs35705950 is associated with increased risk of idiopathic pulmonary fibrosis susceptibility, severity, and the decreased overall survival.
26595739 The MUC5B promoter polymorphism is the strongest and the most replicated genetic risk factor for Idiopathic pulmonary fibrosis. It is involved in disease pathogenesis through an increase in MUC5B expression in terminal bronchi and honeycombed cysts.
26539479 We propose a mechanism whereby MUC5B decreases surface tension lowering capacity of alveolar surfactant at areas with maximal mechanical stress
26514822 MUC5B promoter genotype was not associated with high attenuation areas on lung computed tomography.
26512610 strong association between the MUC5B promoter rs35705950 minor T allele and idiopathic pulmonary fibrosis susceptibility particularly evident in the Caucasian population, milder but still significant in the Asian population [meta-analysis]
26331942 MUC5B has recently been shown to be associated with idiopathic pulmonary fibrosis susceptibility and survival. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201505-1010OC#.VwqiYdLrvyA
26224019 MUC5B is a novel prognostic biomarker for patients with non-small cell lung cancer (NSCLC)carrying EGFR mutations but not for patients with NSCLC carrying wild-type EGFR
26057585 These results suggest that MUC5B production can be regulated by ECM components and that MUC5B is upregulated by fibronectin and laminin via the integrin, ERK, and NF-kappaB dependent pathway.
25926289 MUC5B polymorphism confers susceptibility to idiopathic pulmonary fibrosis in Europeans and Asians--{review}
25858779 MUC5B may play a role in the development of pediatric fibrotic lung disease in patients with Surfactant Protein C mutations
25733373 the combination of MUC5B and TTF-1 expression is useful for discriminating adenocarcinomas from squamous cell carcinomas, yielding prognostic significance in patients with lung adenocarcinoma.
25638393 Increased expression of MUC5B was associated with bacterial biofilm formation in chronic rhinosinusitis patients.
25581455 this is the first study to successfully validate the association between rs35705950 and IPF in a Japanese ethnicity.
25420179 An increase of MUC5B abundance found in the sinus secretions of pediatric patients with chronic rhinosinusitis.
25333937 Both compounds down regulated mucin 5 subtype B, and peptidoglycan recognition protein 1 in vaginal tissue
25317858 The T allele at rs35705950 of the MUC5B gene is associated with usual interstitial pneumonitis
25121989 Mucin 5B promoter polymorphism is associated with the risk for interstitial lung diseases mainly in older male Chinese subjects
24924948 The MUC5B rs2672794 CC genotype was associated with a significantly increased risk of coal workers' pneumoconiosis, compared with the TT genotype.
24885580 These results suggest that visfatin induces MUC8 and MUC5B expression through p38 MAPK/ROS/NF-kappaB signaling pathway in human airway epithelial cells.
24840470 The expression of a subset of mucins (MUC2, MUC6, MUC5B) was also correlated with sialyl-Tn expression in LS174T cells.
24792379 TSLP induces MUC5B expression via the ERK1/2 and p38 MAPK signaling pathway in human airway epithelial cells.
24717875 These results show for the first time that Staphylococcus enterotoxin A induces MUC5B expression via TLR2, ERK1/2, and p38 MAPK signaling pathway in human airway epithelial cells.
24547893 Review of the genetics of pulmonary fibrosis focusing on the recent genetic findings of MUC5B.
24441930 Adolescents with very high intensity of dental caries disease had increased levels of MUC1 and MUC5B.
24434656 This study suggests that although both MUC5B and TERT polymorphisms confer independent risks for interstitial lung disease (ILD), MUC5B rs35705950 may, in particular, contribute differentially to idiopathic pulmonary fibrosis and other ILD entities.
24332705 Sputum is not inert and degradation reduces apparent mucin concentrations and sputum elasticity.
23940607 Genetic association between MUC5B promoter variants and idiopathic pulmonary fibrosis. {Meta-analysis]
23929584 One SNP in the MUC5B gene having association with chronic otitis media with effusion in study population.
23807779 we report the expression pattern of MUC2, MUC5AC, MUC5B, and MUC6 in a large series of colorectal carcinomas
23783374 Patients with high cilium gene expression demonstrate more microscopic honeycombing, but not fibroblastic foci, and have elevated tissue expression of MUC5B and Matrix Metalloproteinase 7.
23695349 Among patients with idiopathic pulmonary fibrosis, a common risk polymorphism in MUC5B was significantly associated with improved survival
23692170 The MUC5B promoter polymorphism was found to be associated with interstitial lung disease in the general population.
23527003 The frequency of MUC5B+ and MUC5AC+ distal airways was increased in idiopathic pulmonary fibrosis. MUC5B-expressing cells were the dominant mucus cell type in the honeycomb cyst epithelium.
23406586 These results suggest that chitinase induces MUC5B expression by activation of the p38 MAPK signaling pathway in human airway epithelial cells.
23321605 The MUC5B variant was not a risk factor for lung fibrosis in patients with SSc or sarcoidosis and did not predict more rapidly progressive lung disease in any of the groups.
23249391 Findings suggest that normal regulation of MUC5AC and MUC5B production by human bronchial epithelial cells is TGF-beta isoform-specific and that TGF-beta(2) downregulates both MUC5AC and MUC5B.
23207284 [review] Reduced salivary flow and decreased quality of salivary mucins are likely to be responsible for xerostomia in patients with Sjogren's syndrome.
22802285 Article reviews genetic and environmental causes of pulmonary fibrosis, specifically focusing on genetic and epigenetic variants of MUC5B and why only some individuals with the MUC5B promoter polymorphism develop pulmonary fibrosis [Review Article]
22591690 A high frequency of MUC5B apoprotein is expressed in alveolar macrophages of bronchial alveolar lavage fluid obtained from long-term smokers with chronic obstructive pulmonary disease.
22576636 The pulmonary fibrosis-associated MUC5B promoter polymorphism does not influence the development of interstitial pneumonia in systemic sclerosis.
22391959 Macrophages are related to goblet cell hyperplasia and induce MUC5B but not MUC5AC in human bronchus epithelial cells.
22269464 Similar MUC1, MUC2 and MUC5B expression patterns were observed between mucocele-like lesions and mucinous carcinoma (MC) type A and between MC type B and mucinous carcinoma.
21981454 Agonists of TRPV1 and TRPA1 induced MUC5B release in the human nasal airways in vivo.
21832046 PGD(2) can induce MUC5B overproduction via ERK MAPK/RSK1/CREB signaling and that DP1 receptor may have suppressive effects in controlling MUC5B overproduction in the airway.
21619869 results of this study show that AMPK induces MUC5B expression through the p38 MAPK signaling pathway in airway epithelial cells.
21618303 Diallyl disulfide induced MUC5B expression and activated phosphorylation of ERK1/2 MAPK in airway epithelial cells.
21596555 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21506748 We confirm a recent association with rs35705950 in the putative promoter of MUC5B and sporadic idiopathic pulmonary fibrosis.
21506741 we identified a common variant in the putative promoter of the gene encoding mucin 5B (MUC5B) that is associated with the development of both familial interstitial pneumonia and sporadic idiopathic pulmonary fibrosis.
21455588 AQP5 expression increases MUC5AC and MUC5B mucin production
21194732 the ultrastructural distribution of the MUC5B mucin in human palatal and buccal glands
21097527 MCP-1 has a novel function in airway epithelium, increasing the two major airway mucins MUC5AC and MUC5B, an effect mediated, at least in part, by a cascade of events initiated by interaction of its receptor CCR2B with G(q) subunits in caveolae
20946627 MUC5B and MUC7 from HIV patients, unlike the MUC5B and MUC7 from HIV negative individuals, did not inhibit HIV-1 activity.
20946627 Salivary agglutinin and mucin, as well as several lower-molecular-weight proteins interact with HIV-1 to strip gp120 from the virus
20873538 IL-1 beta increased MUC2/MUC5B mRNA levels in human nasal epithelial cells.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20497020 Leptin up-regulates MUC5B expression in human airway epithelial cells via activation of ERK1/2 or p38 MAPK.
20422702 In human nasal polyp epithelial cells, leptin increased the expression of MUC5AC and MUC5B, in a dose- and time-dependent manner, at the gene and protein levels.
19783639 The structure of the MUC5B in its unpacking state was studied.
19718741 This study compared polymorphisms in MUC2, MUC5AC, and MUC5B genes in otitis media (OM) patients and controls.
19718741 Observational study of gene-disease association. (HuGE Navigator)
19596978 a high concentration of IL-8 is required to increase MUC5B mRNA levels in primary normal differentiated human bronchial epithelial cells
19556605 NRG1beta1 is a novel mediator of MUC5AC and MUC5B expression in HBECs, and may represent a novel therapeutic target for mucus hypersecretion in respiratory diseases.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19191526 A statistically significant association between the long rare MUC5B-MS6 alleles and the occurrence of bladder cancer was identified in the younger group (<60; odds ratio, 4.54; 95% confidence interval, 1.0-20.7; p=0.03).
19191526 Observational study of gene-disease association. (HuGE Navigator)
19118346 The solution MUC5B and gelMUC5B preparations exhibited different biological activity when assayed with freshly plaque bacteria in suspension and in a biofilm.
18976975 Knockdown of mucin 5B, oligomeric mucus/gel-forming (MUC5B) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
18776153 MUC5B (mucin 5B) is the major mucin in the gel phase of sputum in chronic obstructive pulmonary disease
18757307 Results show that oxidative stress induces MUC5B up-regulation, which requires CD44 as well as EGFR and MAPK activation.
18688042 E2, a sex hormone, stimulates MUC5B gene overexpression by interaction with estrogen receptor alpha (ERalpha) and by acting through extracellular signal-regulated kinase 1/2 (ERK1/2)-mitogen-activated protein kinase (MAPK).
17703412 Observational study of gene-disease association. (HuGE Navigator)
17671696 both the MUC1-N and MUC1-C subunits evolved from secreted gel-forming mucins and that the MUC1-CD oncogenic function emerged by diversification after evolution from MUC5B
17621824 Thus gene is up-regulated in sinus mucosa of chronic rhinosinusitis and nasal polyposis.
17471237 this study demonstrates the important role for methylation and/or histone modifications in regulating the 11p15 mucin genes in epithelial cancer cells.
17125499 Salivary agglutinin and mucin, as well as several lower-molecular-weight proteins interact with HIV-1 to strip gp120 from the virus
17063754 MUC5B mucin gene product secretion is significantly increased in chronic sinusitis compared with control subjects.
16540890 Up-regulation of MUC5B in the ear may play an important role in the pathogenesis of middle ear effusions.
16188033 MUC1, MUC5B and MUC8, but not MUC2 or MUC5AC, are up-regulated in endometrial adenocarcinomas
15709052 Possible involvement of MUC5B gene in diffuse panbronchiolitis is demonstrated.
15563276 There were significant differences were found in the glycosylation of MUC5B/MUC5AC or gp-340 between CF and non-CF subjects with severe lung disease, implying that CF does not influence SMG secretion mucin glycosylation in end-stage lung disease.
14988081 The concentration of MUC5AC and MUC5B are decreased in the CF airways relative to normal mucus. This may be due to a relative increase in other components of sputum in the CF airway or to a primary defect in mucin secretion in CF.
14758553 expression was observed in 22.0% of the gastric carcinomas and was associated with the "unclassified" histological type and with the absence of venous invasion; expression had no impact on survival and was associated with the co-expression of MUC5AC
14690056 MUC5B and MUC4 were major mucins in MOM that formed distinct treelike polymers (mucus strands)in the middle ear mucosa with mucoid otitis media
12768436 Observational study of genotype prevalence. (HuGE Navigator)
12756239 results suggest that oligomeric mucin 5, subtype B(MUC5B) in saliva is assembled into much larger linear or branched assemblies through calcium-mediated protein cross-links
12459324 Level of MG1 is lower in saliva of subjects with dental disease
11996097 Structure and biosynthesis of human salivary mucins.
11853536 saliva has additional structure and organization not present in the purified MUC5B mucin
11825880 analysis of repertoire of unique oligosaccharides
11062147 Observational study of gene-disease association. (HuGE Navigator)
9815215 Salivary agglutinin and mucin, as well as several lower-molecular-weight proteins interact with HIV-1 to strip gp120 from the virus

AA Sequence

MGAPSACRTLVLALAAMLVVPQAETQGPVEPSWENAGHTMDGGAPTSSPTRRVSFVPPVTVFPSLSPLNP      1 - 70
AHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRRGLVGSRPVVTRVVIKAQGLV     71 - 140
LEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDF    141 - 210
NGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLPLPAGNCTDEEGICHRTLLGPAFAECHALVDS    211 - 280
TAYLAACAQDLCRCPTCPCATFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQ    281 - 350
RAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLP    351 - 420
CPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTDNENCLKAVTLSLDGGDT    421 - 490
AIRVQADGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCG    491 - 560
LCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARNSFEDPCSLSVENENYARHWCSRLTDPNS    561 - 630
AFSRCHSIINPKPFHSNCMFDTCNCERSEDCLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQR    631 - 700
YAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPAGTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDE    701 - 770
GAVCSCTGGKLSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPG    771 - 840
LVSDGSGGCIAEEDCPCVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGDGHFITFDGDR    841 - 910
YSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARGPGG    911 - 980
DPPYKIRYMGIFLVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALE    981 - 1050
FGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGG   1051 - 1120
DCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDL   1121 - 1190
PGLEGCYPKCPPSQPFFNEDQMKCVAQCGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEACT   1191 - 1260
CTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALPVS   1261 - 1330
TVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLADIECRAAQLPDMPLEELGQQVDCD   1331 - 1400
RMRGLMCANSQQSPPLCHDYELRVLCCEYVPCGPSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWV   1401 - 1470
TPSIRSTAALTSQTGSSSGPVTVTPSAPGTTTCQPRCQWTEWFDEDYPKSEQLGGDVESYDKIRAAGGHL   1471 - 1540
CQQPKDIECQAESFPNWTLAQVGQKVHCDVHFGLVCRNWEQEGVFKMCYNYRIRVLCCSDDHCRGRATTP   1541 - 1610
PPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLGTATTGGPTTPAGS   1611 - 1680
TEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMATSRARPTGTASTASKEPLTTSLAPTLT   1681 - 1750
SELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGK   1751 - 1820
MCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPSTPA   1821 - 1890
TSSTATPSSTPGTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPSSSPG   1891 - 1960
TATALPALRSTATTPTATSVTPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTATATTT   1961 - 2030
GATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTH   2031 - 2100
TATVLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPA   2101 - 2170
ATSNTVTPSSALGTTHTPPVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAA   2171 - 2240
TTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVV   2241 - 2310
TMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECS   2311 - 2380
LDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTESTG   2381 - 2450
STATPSSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPFSSPGTAT   2451 - 2520
ALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGAT   2521 - 2590
GSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTARTLPVWISTTTTPTTRGSTVTPSSIPGTTHTPT   2591 - 2660
VLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAATS   2661 - 2730
STVTPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTG   2731 - 2800
TTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMG   2801 - 2870
CEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDF   2871 - 2940
GLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTATTGSTA   2941 - 3010
IPSSTPGTAPPPKVLTSTATTPTATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIPSFTLGTTGTL   3011 - 3080
PEQTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRATSSMSTPSSTPGTTWILTELTTAATTTAATGP   3081 - 3150
TATPSSTPGTTWILTEPSTTATVTVPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTAT   3151 - 3220
ALPALRSTATTPTATSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRAT   3221 - 3290
GSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTHTAT   3291 - 3360
VLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAATS   3361 - 3430
STVTPSSALGTTHTPPVPNTTATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTPAATTS   3431 - 3500
TTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTG   3501 - 3570
CEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDF   3571 - 3640
GLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTTESTGSTA   3641 - 3710
TPSSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPFSSPGTATALP   3711 - 3780
ALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTTTATTTRATGSV   3781 - 3850
ATPSSTPGTAHTTKVPTTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLT   3851 - 3920
TTTTTVATGSMATPSSSTQTSGTPPSLITTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAATSSTV   3921 - 3990
TPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQ   3991 - 4060
HSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEP   4061 - 4130
QCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLV   4131 - 4200
CRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPS   4201 - 4270
STPGTAPPPKVLTSPATTPTATSSKATSSSSPRTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLPEQ   4271 - 4340
TTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAATTTAATGPTAT   4341 - 4410
PSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPH   4411 - 4480
VSTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTA   4481 - 4550
TPSSTPETVHTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWIS   4551 - 4620
TTTTPTTTTPTTSGSTVTPSSIPGTTHTARVLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITAT   4621 - 4690
GSTTNPSSTPGTTPITPVLTSTATTPAATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIPSSTLWT   4691 - 4760
TWTVPAQTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNSTATPSSTLGTTRILTELTTTATTTA   4761 - 4830
ATGSTATLSSTPGTTWILTEPSTIATVMVPTGSTATASSTLGTAHTPKVVTTMATMPTATASTVPSSSTV   4831 - 4900
GTTRTPAVLPSSLPTFSVSTVSSSVLTTLRPTGFPSSHFSTPCFCRAFGQFFSPGEVIYNKTDRAGCHFY   4901 - 4970
AVCNQHCDIDRFQGACPTSPPPVSSAPLSSPSPAPGCDNAIPLRQVNETWTLENCTVARCVGDNRVVLLD   4971 - 5040
PKPVANVTCVNKHLPIKVSDPSQPCDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHARFG   5041 - 5110
NLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSV   5111 - 5180
LGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTW   5181 - 5250
LVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC   5251 - 5320
RGRLEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAE   5321 - 5390
GCFCPEDQILFNAHMGICVQACPCVGPDGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPC   5391 - 5460
NRPGFVTVTRPRAENPCCPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFY   5461 - 5530
GVGATFPGALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGECVQTACLTPDGQPVQ   5531 - 5600
LNETWVNSHVDNCTVYLCEAEGGVHLLTPQPASCPDVSSCRGSLRKTGCCYSCEEDSCQVRINTTILWHQ   5601 - 5670
GCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPF   5671 - 5740
CVPAPMAPPHTRGFPAQEATAV                                                   5741 - 5762
//

Text Mined References (127)

PMID Year Title
26871673 2016 MUC5B Promoter Variant rs35705950 Affects MUC5B Expression in the Distal Airways in Idiopathic Pulmonary Fibrosis.
26871672 2016 Mucins MUC5B and MUC5AC in Distal Airways and Honeycomb Spaces: Comparison among Idiopathic Pulmonary Fibrosis/Usual Interstitial Pneumonia, Fibrotic Nonspecific Interstitial Pneumonitis, and Control Lungs.
26823827 2015 Association between MUC5B polymorphism and susceptibility and severity of idiopathic pulmonary fibrosis.
26595739 2015 MUC5B and Idiopathic Pulmonary Fibrosis.
26539479 2015 Understanding Idiopathic Interstitial Pneumonia: A Gene-Based Review of Stressed Lungs.
26514822 2015 A comparison of visual and quantitative methods to identify interstitial lung abnormalities.
26512610 2015 Association Between the MUC5B Promoter Polymorphism rs35705950 and Idiopathic Pulmonary Fibrosis: A Meta-analysis and Trial Sequential Analysis in Caucasian and Asian Populations.
26331942 2015 TOLLIP, MUC5B, and the Response to N-Acetylcysteine among Individuals with Idiopathic Pulmonary Fibrosis.
26224019 2015 A favourable prognostic marker for EGFR mutant non-small cell lung cancer: immunohistochemical analysis of MUC5B.
26057585 2015 MUC5B mucin production is upregulated by fibronectin and laminin in human lung epithelial cells via the integrin and ERK dependent pathway.
25926289 2015 A meta-analysis examining the association between the MUC5B rs35705950 T/G polymorphism and susceptibility to idiopathic pulmonary fibrosis.
25858779 2015 MUC5B expression and location in surfactant protein C mutations in children.
25733373 2015 Diagnostic and prognostic significances of MUC5B and TTF-1 expressions in resected non-small cell lung cancer.
25638393 2015 Increased expression of MUC5AC and MUC5B promoting bacterial biofilm formation in chronic rhinosinusitis patients.
25581455 2015 MUC5B promoter polymorphism in Japanese patients with idiopathic pulmonary fibrosis.
25420179 2015 Proteomic analysis of pediatric sinonasal secretions shows increased MUC5B mucin in CRS.
25333937 2014 New candidate biomarkers in the female genital tract to evaluate microbicide toxicity.
25317858 2015 CT scan findings of probable usual interstitial pneumonitis have a high predictive value for histologic usual interstitial pneumonitis.
25121989 2014 Mucin 5B promoter polymorphism is associated with susceptibility to interstitial lung diseases in Chinese males.
24924948 2014 MUC5B promoter polymorphisms and risk of coal workers' pneumoconiosis in a Chinese population.
24885580 2014 Visfatin induces MUC8 and MUC5B expression via p38 MAPK/ROS/NF-?B in human airway epithelial cells.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
24792379 2014 Effect of thymic stromal lymphopoietin on MUC5B expression in human airway epithelial cells.
24717875 Staphylococcus enterotoxin A induces MUC5B expression via Toll-like receptor 2, extracellular signal-regulated kinase 1/2, and p38 mitogen-activated protein kinase in human airway epithelial cells.
24547893 2014 Genetics and early detection in idiopathic pulmonary fibrosis.
24441930 2014 Mucin levels in saliva of adolescents with dental caries.
24434656 2014 Association between MUC5B and TERT polymorphisms and different interstitial lung disease phenotypes.
24429156 2013 Genetic variants associated with idiopathic pulmonary fibrosis susceptibility and mortality: a genome-wide association study.
24332705 2014 Reassessment of the importance of mucins in determining sputum properties in cystic fibrosis.
23940607 2013 The MUC5B variant is associated with idiopathic pulmonary fibrosis but not with systemic sclerosis interstitial lung disease in the European Caucasian population.
23929584 2014 Genetic susceptibility to chronic otitis media with effusion: candidate gene single nucleotide polymorphisms.
23807779 2013 Expression of MUC2, MUC5AC, MUC5B, and MUC6 mucins in colorectal cancers and their association with the CpG island methylator phenotype.
23783374 2013 Expression of cilium-associated genes defines novel molecular subtypes of idiopathic pulmonary fibrosis.
23695349 2013 Association between the MUC5B promoter polymorphism and survival in patients with idiopathic pulmonary fibrosis.
23692170 2013 MUC5B promoter polymorphism and interstitial lung abnormalities.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23527003 2013 The idiopathic pulmonary fibrosis honeycomb cyst contains a mucocilary pseudostratified epithelium.
23406586 2013 Effect of Onchocerca volvulus chitinase on MUC5B expression in human airway epithelial cells.
23321605 2013 Mucin 5B promoter polymorphism is associated with idiopathic pulmonary fibrosis but not with development of lung fibrosis in systemic sclerosis or sarcoidosis.
23249391 2013 TGF-?? decreases baseline and IL-13-stimulated mucin production by primary human bronchial epithelial cells.
23207284 2013 Oral dryness in Sjögren's syndrome patients. Not just a question of water.
22802285 2012 The genetic and environmental causes of pulmonary fibrosis.
22591690 2012 Mucin5B expression by lung alveolar macrophages is increased in long-term smokers.
22576636 2012 The pulmonary fibrosis-associated MUC5B promoter polymorphism does not influence the development of interstitial pneumonia in systemic sclerosis.
22391959 2012 Macrophages are related to goblet cell hyperplasia and induce MUC5B but not MUC5AC in human bronchus epithelial cells.
22269464 2012 Expression of MUC1, MUC2, MUC5AC and MUC5B in mucinous lesions of the breast.
21981454 2011 TRPV1 and TRPA1 stimulation induces MUC5B secretion in the human nasal airway in vivo.
21832046 2011 The extracellular signal-regulated kinase mitogen-activated protein kinase/ribosomal S6 protein kinase 1 cascade phosphorylates cAMP response element-binding protein to induce MUC5B gene expression via D-prostanoid receptor signaling.
21619869 2011 AMPK induces MUC5B expression via p38 MAPK in NCI-H292 airway epithelial cells.
21618303 2012 Diallyl disulfide induces MUC5B expression via ERK2 in human airway epithelial cells.
21596555 2012 Polymorphisms in MUC1, MUC2, MUC5B and MUC6 genes are not associated with the risk of chronic atrophic gastritis.
21506748 2011 A variant in the promoter of MUC5B and idiopathic pulmonary fibrosis.
21506741 2011 A common MUC5B promoter polymorphism and pulmonary fibrosis.
21455588 2011 Aquaporin 5 expression increases mucin production in lung adenocarcinoma.
21194732 2011 Electron microscopic immunogold localization of salivary mucin MUC5B in human buccal and palatal glands.
21097527 2011 MCP-1/CCR2B-dependent loop upregulates MUC5AC and MUC5B in human airway epithelium.
20946627 2010 Anti-HIV-1 activity of salivary MUC5B and MUC7 mucins from HIV patients with different CD4 counts.
20873538 2010 [Interleukin-1beta induces MUC2/MUC5B gene expression in human nasal epithelial cells].
20572857 2010 Protein and mucin retention on oral mucosal surfaces in dry mouth patients.
20531251 2010 MUC5B Is the predominant mucin glycoprotein in chronic otitis media fluid.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20497020 2010 Leptin up-regulates MUC5B expression in human airway epithelial cells via mitogen-activated protein kinase pathway.
20422702 2010 Expression of leptin receptor in nasal polyps: leptin as a mucosecretagogue.
20197185 2010 Identification of salivary proteins at oil-water interfaces stabilized by lysozyme and beta-lactoglobulin.
20156260 2010 Ultrastructural localization of salivary mucins MUC5B and MUC7 in human labial glands.
20081098 2010 Induced sputum concentrations of mucin in patients with asthma and chronic cough.
20066894 2009 Identification of genes with differential expression in chemoresistant epithelial ovarian cancer using high-density oligonucleotide microarrays.
19783639 2010 Unpacking a gel-forming mucin: a view of MUC5B organization after granular release.
19718741 2010 Mucin gene polymorphisms in otitis media patients.
19596978 2009 IL-8 regulates mucin gene expression at the posttranscriptional level in lung epithelial cells.
19556605 2010 Regulation of neuregulin 1beta1-induced MUC5AC and MUC5B expression in human airway epithelium.
19556293 2009 Proteolytic degradation of human salivary MUC5B by dental biofilms.
19452580 2009 Mucin gene expression in bile of patients with and without gallstone disease, collected by endoscopic retrograde cholangiography.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19191526 2009 Variants of MUC5B minisatellites and the susceptibility of bladder cancer.
19118346 2009 Differential metabolic activity by dental plaque bacteria in association with two preparations of MUC5B mucins in solution and in biofilms.
19077699 2009 Mucus hypersecretion in asthma: causes and effects.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18817906 2009 Higher levels of salivary MUC5B and MUC7 in individuals with gastric diseases who harbor Helicobacter pylori.
18776153 2008 MUC5B is the major mucin in the gel phase of sputum in chronic obstructive pulmonary disease.
18757307 2009 Hyaluronan fragments/CD44 mediate oxidative stress-induced MUC5B up-regulation in airway epithelium.
18688042 2009 Signal pathway of 17beta-estradiol-induced MUC5B expression in human airway epithelial cells.
18339669 2008 Analyzing the functions of large glycoconjugates through the dissipative properties of their absorbed layers using the gel-forming mucin MUC5B as an example.
18282555 2008 Mucins MUC5B and MUC7 in minor salivary gland secretion of children and adults.
18272164 2008 Studies on the exchange of early pellicle proteins by mucin and whole saliva.
17998215 2008 Reduced sulfation of muc5b is linked to xerostomia in patients with Sjögren syndrome.
17850213 2008 Structure and function of the polymeric mucins in airways mucus.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17671696 2007 Evolution of the human MUC1 oncoprotein.
17621824 The expression of MUC5AC and MUC5B mucin genes in the mucosa of chronic rhinosinusitis and nasal polyposis.
17606809 2007 Globular structure of human ovulatory cervical mucus.
17473699 2007 Upper airway mucin gene expression: a review.
17471237 2007 Epigenetic regulation (DNA methylation, histone modifications) of the 11p15 mucin genes (MUC2, MUC5AC, MUC5B, MUC6) in epithelial cancer cells.
17063754 MUC5B secretion is up-regulated in sinusitis compared with controls.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16540890 2006 Up-regulation of MUC5AC and MUC5B mucin genes in nasopharyngeal respiratory mucosa and selective up-regulation of MUC5B in middle ear in pediatric otitis media with effusion.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16341674 2005 Transcriptome analysis of human gastric cancer.
16188033 2005 Differential expression of MUC genes in endometrial and cervical tissues and tumors.
15709052 2005 Promoter analysis and aberrant expression of the MUC5B gene in diffuse panbronchiolitis.
15563276 2005 Mucin glycosylation changes in cystic fibrosis lung disease are not manifest in submucosal gland secretions.
14988081 2004 MUC5AC and MUC5B Mucins Are Decreased in Cystic Fibrosis Airway Secretions.
14758553 2004 MUC5B expression in gastric carcinoma: relationship with clinico-pathological parameters and with expression of mucins MUC1, MUC2, MUC5AC and MUC6.
14718370 2004 C-Mannosylation of MUC5AC and MUC5B Cys subdomains.
14690056 2003 Expression of mucins in mucoid otitis media.
12768436 2003 Characterization of 458 single nucleotide polymorphisms of disease candidate genes in the Korean population.
12756239 2003 Calcium-dependent protein interactions in MUC5B provide reversible cross-links in salivary mucus.
12459324 Electrophoretic analysis of whole saliva and prevalence of dental caries. A study in Mexican dental students.
11996097 2000 Structure and biosynthesis of human salivary mucins.
11853536 2002 Concentrated solutions of salivary MUC5B mucin do not replicate the gel-forming properties of saliva.
11825880 2002 The salivary mucin MG1 (MUC5B) carries a repertoire of unique oligosaccharides that is large and diverse.
11713095 2001 Characterization of human mucin 5B gene expression in airway epithelium and the genomic clone of the amino-terminal and 5'-flanking region.
11445551 2001 In vivo glycosylation of mucin tandem repeats.
11062147 2000 Polymorphism of human mucin genes in chest disease: possible significance of MUC2.
10217161 1999 Fifty-nine bp repeat polymorphism in the uncommon intron 36 of the human mucin gene MUC5B.
9804771 1998 Genomic organization of the human mucin gene MUC5B. cDNA and genomic sequences upstream of the large central exon.
9790959 1998 The amino-terminal sequence of MUC5B contains conserved multifunctional D domains: implications for tissue-specific mucin functions.
9201995 1997 Genomic organization of the 3' region of the human mucin gene MUC5B.
9164870 1997 Molecular cloning of a major human gall bladder mucin: complete C-terminal sequence and genomic organization of MUC5B.
9147051 1997 Identification of a major human high molecular weight salivary mucin (MG1) as tracheobronchial mucin MUC5B.
9013550 1997 Human mucin gene MUC5B, the 10.7-kb large central exon encodes various alternate subdomains resulting in a super-repeat. Structural evidence for a 11p15.5 gene family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8554565 1995 Molecular cloning of a novel high molecular weight mucin (MG1) from human sublingual gland.
7916618 1993 Degenerate 87-base-pair tandem repeats create hydrophilic/hydrophobic alternating domains in human mucin peptides mapped to 11p15.
7513696 1994 Cloning and analysis of cDNA encoding a major airway glycoprotein, human tracheobronchial mucin (MUC5).
2656675 1989 Proteolytic fragmentation and peptide mapping of human carboxyamidomethylated tracheobronchial mucin.
1718282 1991 Statherin: a major boundary lubricant of human saliva.