Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.16
PubTator Score 14.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.500 1.5e-03
lung adenocarcinoma 1.600 2.6e-04
non-small cell lung carcinoma 1.900 2.5e-11
psoriasis -1.500 4.3e-05

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
20388707 Mucin 21/epiglycanin modulates cell adhesion
19851445 Observational study of gene-disease association. (HuGE Navigator)
17977904 Identification and expression of human epiglycanin/MUC21: a novel transmembrane mucin

AA Sequence

MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTATISGSSVTSN      1 - 70
GVSIVTNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTATNSESSTPSSGASTATNSDS     71 - 140
STTSSGASTATNSDSSTTSSEASTATNSESSTTSSGASTATNSESSTVSSRASTATNSESSTTSSGASTA    141 - 210
TNSESRTTSNGAGTATNSESSTTSSGASTATNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSS    211 - 280
GISTVTNSESSTPSSGANTATNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSES    281 - 350
STTSSGASTATNSGSSTTSSGTSTATNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTA    351 - 420
TNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMHTTSHSASTAVSEAKPGGSLVPWEIFLITLVSVVA    421 - 490
AVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMS    491 - 560
GRNSGP                                                                    561 - 566
//

Text Mined References (16)

PMID Year Title
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21801394 2011 Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
20388707 2010 Mucin 21/epiglycanin modulates cell adhesion.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
17977904 2008 Identification and expression of human epiglycanin/MUC21: a novel transmembrane mucin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.