Property Summary

NCBI Gene PubMed Count 208
PubMed Score 120.33
PubTator Score 3783.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.700 3.2e-03
cystic fibrosis 1.300 3.5e-04
lung adenocarcinoma 1.500 3.9e-05
nasopharyngeal carcinoma -3.400 1.5e-10
ovarian cancer 2.200 5.4e-04
psoriasis -2.700 5.0e-28

Protein-protein Interaction (10)

Gene RIF (197)

PMID Text
26770020 increased gene expression of MUC16 and MUC20 was found in patients with remission ulcerative colitis
26329844 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level.
26285075 optimal cut-off values (HE4: 70pmol/l for all; CA125: 60U/ml for pre- and 35U/ml for postmenopausal women) could notably improve diagnostic performance in EOC detection in patients in southern China
26246541 the diagnostic value of serum cancer antigen (CA)125, CA19-9 and CA15-3 concentrations in endometriosis, was evaluated.
26176088 Suggest preoperative serum level of CA19-1 may be more useful than CEA, CA72-4, AFP and CA125 levels as a prognostic factor in gastric cancer.
26163610 Elevation of serum CA125 is associated with Non-small Cell Lung Cancer.
26143638 Data suggest that dual inhibition of vascular endothelial growth factor (VEGF) and CA125 protein might bring about a better outcome for patients with epithelial ovarian cancer (EOC).
26122176 IL-6 was found to be strongly associated with advanced serous EOC and could be used in combination with serum CA125 to discriminate benign and epithelial ovarian carcinoma
26046375 Results demonstrate that MUC16 plays an important role in metabolic reprogramming of pancreatic cancer cells by increasing glycolysis and enhancing motility and invasiveness.
26045023 The CA125, HE4, and ROMA values differed significantly depending on the presence of peritoneal dissemination (p < 0.0001).
25978292 Elevated CA125 seems to be associated with the presence of peritoneal implants of any type at initial diagnosis of serous Borderline Tumors of the Ovary.
25968305 An increased preoperative CA125 level is an independent predictor of worse clinical outcomes after off pump coronary artery bypass grafting during a 1-year follow-up.
25967705 High expression of CA125 was found in patients with endometriosis that was curative with laparoscopy.
25965947 Results show that the carboxy-terminal portion of the MUC16 protein is oncogenic in NIH/3T3 cells, increases invasive tumor properties, activates the AKT and ERK pathways, and contributes to the biologic properties of ovarian cancer.
25951715 Significant differences were shown between endometrioma versus teratoma groups for fibrinogen level (3.12 mg% vs. 2.57 mg%; p = 0.001) and CA-125 (36.50 U/mL vs. 15.08 U/mL; p = 0.001).
25891047 Benign leiomyoma accompanied by pseudo-Meigs' syndrome and elevated serum CA125 can mimic a pelvic malignancy
25875367 In patients with acute heart failure, Gal-3 was strongly associated with higher risk of long-term mortality and repeated rehospitalizations, but only in those patients exhibiting higher values of CA125 (above 67 U/ml).
25834501 The significant difference was observed in patients with endometriosis/endometriomas in which HE4 was not elevated patients and CA125 was elevated in 53% (P<0.001).
25799488 Data found LRG1 as a promising candidate marker for detection of epithelial ovarian cancer (EOC) and the combination of LRG1 and CA125 showed improved performance to distinguish EOC including early stage EOC from non-cases compared to CA125.
25691062 MUC16-Cter mediated enrichment of CSCs is partly responsible for tumorigenic, metastatic and drug-resistant properties of pancreatic cancer cells.
25667483 An association between strong claudin-5 expression and higher serum levels of TATI (p=0.04) and CA125 (p=0.008) were found
25577553 In the differential diagnosis of adenomyosis and myoma, cut-off values for CA125, particularly the cut-off value of 19 U/mL, provide improved diagnostic performance.
25563498 MAMs MUC1 and MUC16 contribute to the maintenance of immune homeostasis at the ocular surface by limiting TLR-mediated innate immune responses.
25531720 The combined detection of CYFRA21-1, CA125, SCC and CA153 is an effective way to distinguish benign and malignant SPN, and will find an important clinical application in the early diagnosis of SPN.
25458668 A combined CEA and CA 125 approach may help segregate mucinous cystic neoplasms from intraductal papillary mucinous neoplasms
25454345 Detection of glyco-mucin profiles improves specificity of MUC16 and MUC1 biomarkers in ovarian serous tumours.
25416055 High serum CA19-9 and CA125 is associated with cystic teratoma of the ovary.
25344872 Elevated serum CA125 in patients with metastatic or recurrent gastric cancer was an independent negative predictor of prognosis.
25326813 Measurement of combined HE4 and CA125 levels provides a more accurate method for epithelial ovarian cancer diagnosis.
25279712 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
25256054 CA-125 level is associated with the development of AF in patients with hospitalized systolic HF.
25217152 No prognostic benefit was found in measuring effuent CA125 in peritoneal dialysis patients with acute peritonitis.
25205731 proteolytic clearing of MUC16/CA-125, catalyzed by MT1-MMP, may then expose integrins for high-affinity cell binding to peritoneal tissues
25197000 Both the serum CA125(meso) level and the ratio of the serum CA125(meso) to CA125 levels (CA125(meso) /CA125) were significantly higher in patients with EOC.
25190018 Serum HE4 and CA125 as predictors of response and outcome during neoadjuvant chemotherapy of advanced high-grade serous ovarian cancer.
25174623 Combinational analysis of CA125 with Trx1 for the detection of ovarian cancer suggests that the diagnostic capacity of CA125 alone for the early detection of ovarian cancer is significantly improved by its combination with Trx1.
25118488 In patients with ovarian endometriosis, serum CA125 was significantly higher than in controls, and decreased after surgical treatment.
25048447 Integrating the dual-signal amplification strategy, a novel 3D origami electrochemical immunodevice for simultaneous detecting carcinoembryonic antigen (CEA) and cancer antigen 125 (CA125)
24968021 role of MUC1 and MUC16 in epithelial barrier function
24939955 MUC1, MUC4, and MUC16 expression does not vary significantly in normal endometrium during the menstrual cycle or in endometriosis relative to the epithelial marker, cytokeratin-18 (KRT18).
24913812 The elevation of CA125 before treatment predicts a poor prognosis in patients with multiple brain metastases from non-small cell lung cancer before and after treatment of whole-brain radiotherapy.
24879526 These results indicate that CA15-3, CA125, CEA, and TSGF in nipple discharge can serve as novel biomarkers in the diagnosis and prognosis of breast cancer.
24831034 Serum CA125 levels that remain elevated after CHD onset could be helpful for predicting the short-term risk of heart failure events in CHD patients.
24812549 The loss of Muc16 in the conjunctiva affected the homeostasis of the corneal epithelium and stroma. The mechanism might include the upregulation of the inflammatory signaling cascade (i.e., Stat3 signal, and IL-6 expression in the KO conjunctiva).
24779300 Elevation of cancer antigen-125 in liver cirrhosis is specific to ascites
24771264 HE4 seems to be superior to Ca125 in terms of diagnostic performance of all premenopausal women
24740561 a slight CA125 increase in the presence of a borderline ovarian tumor should not be overlooked since it can be indicative of a progressive disease
24722639 MUC5AC and MUC16 may have a role in poor outcome in patients with small bowel cancer
24716917 The modified cutoff value of CA125, HE4, RMI score and ROMA were 165.2 U/mL, 103.4 pM, 368.7, 28/54.
24690311 These findings indicate that MUC16 protects EOC cells against TRAIL-induced apoptosis through multiple mechanisms including the blockade of TRAIL R2 expression and the regulation of cFLIP expression at both the transcriptional and the protein level.
24680660 The study was not able to find any significant association between preoperative serum levels of CA 125 and oncological outcome in patients with invasive urothelial carcinoma of the bladder.
24659664 The current study suggests that measurement of preoperative serum CA 125 is a useful clinical tool in the prognosis of patients with endometrial carcinoma
24651630 High serum CA125 levels are associated with low response to therapy in ovarian cancer.
24642341 Serum NSE and CA125 concentrations would provide valuable clinical information to assess disease severity in silicosis
24551091 Seven polymorphisms of MUC16 and MUC1 genes failed to identify and confirm effects on ovarian cancer risk development.
24447304 Suggest targeted TRAIL-based fusion protein Meso-TR3 as a possible therapeutic for patients with MUC16-positive malignancies.
24403483 High CA125 expression is associated with endometrial cancer.
24359057 The greater the enlargement of the uterus over 240 cm(3) volume or 12 weeks' uterine size due to severe adenomyosis, the greater was the rise of CA125 levels; however, similarly enlarged uteri due to fibroids did not show a rise above normal.
24339876 Disrupting the binding of miR-125b toward BMPR1B would increase protein expression, diminishing abnormal cell proliferation as well as serum and cellular CA125 levels
24246580 MUC16 is also associated with the E-cadherin/beta-catenin complex, the over-expression of MUC16 and its interaction with SFKs may enhance SFKs-induced deregulation of E-cadherin.
24204560 MicroRNA-200c modulates the expression of MUC4 and MUC16 by directly targeting their coding sequences in human pancreatic cancer.
24083699 High CA-125 expression is associated with epithelial ovarian tumours.
24060730 CA125 elevation in chronic heart failure was associated with serous cavity effusion.
24039759 Correlation between MUC1 and MUC16 expression and antibody dependent cellular-cytotoxicity and cytotoxic T-lymphocyte mediated cell killing.
24012857 Reference intervals for serum HE4, CA125 and risk of ovarian malignancy algorithm in healthy Chinese female were established.
23925696 Data show that prior mastitis was associated with a significantly higher anti-CA15.3 and anti-CA125 antibody levels and lower risk of ovarian cancer.
23915849 STIP1 histoscores may be useful in detecting invasive human ovarian cancer in patients with low serum CA125 levels.
23886210 High CA125 exprwession is associated with recurrence in breast cancer.
23765208 Elevated CA125 levels are associated with chemotherapy toxicity in older women with ovarian cancer.
23712355 High levels of neuron-specific enolase (NSE), carbohydrate antigen 125 (CA125) and squamous cell carcinoma antigen (SCC) were detected in 306 (63.6%), 89 (18.5%) and 125 (26.0%) non-small cell lung cancer patients, respectively.
23702013 Serum levels of CA125 before and after transcatheter aortic valve implantation independently predict death and major adverse cardiac events.
23687433 The expression of mucin 1, cell surface associated (MUC1) and mucin 16, cell surface associated (MUC16) proteins and messenger ribonucleic acid (mRNA) in a cohort of postmenopausal women, was quantified.
23669443 High CA-125 expression is associated with high grade epithelial ovarian cancer.
23643288 Among the tumor markers evaluated, only CA 125 appeared to be related to the severity of CHF and NT-proBNP, along with the presence of pleural fluid or peripheral edema in patients aged 85 years and older with chronic heart failure.
23613350 The saliva CA125 and TPS concentrations were elevated in patients with oral squamous cell carcinoma
23575338 CA-125 levels in benign pleural effusions may not be influenced by pleural inflammation or hydrostatic or oncotic pressure changes. Pleural CA-125 levels may not be influenced by the histological type of tumour in malignant pleural effusions.
23568007 a high CA-125 level correlates significantly with many clinical features of advanced stage, poor prognostic factors, and worse TFS and OS. However, CA-125 is not an independent prognostic factor in patients with chronic lymphocytic leukemia.
23564055 Preoperative serum levels of CA125 and VEGF were significantly higher in patients with epithelial ovarian cancers compared to those with ovarian cysts. The addition of VEGF to CA125 increased the sensitivity of early ovarian cancer detection.
23560726 Anthropometric measures, dyslipidemia, insulin resistance, and blood pressure were inversely associated with CA-125 (P<0.05); waist circumference and body mass index were also identified as the strongest determinants of CA-125 (P<0.001).
23544943 Immunocytochemistry for MUC4 and MUC16 appears to be a useful adjunct in the classification of pancreatic FNA samples, especially in cases that are equivocal (atypical/suspicious) for adenocarcinoma on cytomorphologic assessment.
23426716 Review: HE4 measurement seems to be superior to CA-125 in terms of diagnostic performance for identification of ovarian cancer.
23414674 Serum CA-125 was related to the activity and severity of pulmonary TB, and it may be useful in the monitoring of therapeutic responses in certain cases of active pulmonary TB, especially in female patients of active pulmonary TB
23357461 Data indicate that binding of mesothelin to CA125 does not alter the measurement of mesothelin for the detection of malignant mesothelioma (MM).
23343214 Measuring serum HE4 concentrations along with CA125 concentrations may provide higher accuracy for detecting epithelial ovarian cancer.
23322523 CA-125 area under the curve could be used as an independent factor for evaluating the treatment efficacy and chemotherapy response in patients who suffer from ovarian cancer
23168398 Surprisingly, in vitro assays performed using recombinant forms of ZmpC indicated that the truncated ZmpC from strain SP168 induces more cleavage of the MUC16 ectodomain than its TIGR4 counterpart.
23095772 The combination of HE4 and CA-125 levels at baseline just before initiation of chemotherapy was significantly associated with decreased progression-free and overall survival and to some extent with platinum resistance.
23053434 Data suggest that expression of cell membrane-associated mucins MUC1, MUC4, and MUC16 are differentially regulated in endocervical epithelial cell aggregates by different bacterial and viral products (here, toll-like receptor ligands/agonists).
22994745 Both the OC and BT patients had elevated CA-125.
22941175 Elevated CA-125 was associated with peritoneal carcinomatosis of appendiceal origin.
22727919 Data suggest that preoperative serum CA-125 can be used as a significant independent predictor of advanced stage of endometrial carcinoma as well as lymph node metastases.
22674301 Data show that the prognostic values of CA125, CA19.9, neuron-speci fi c enolase (NSE), and squamous cell carcinoma antigen (SCC) for stage I non-small-cell lung cancer NSCLC are limited.
22639051 high CA-125 levels as a prognostic factor for overall and progression-free survival rates independent of Follicular Lymphoma International Prognostic Index score variables. CA-125 levels may help to refine risk assessment in the modern immunotherapy era.
22542127 Mucin 16 expression is an independent predictor of poor outcome in pancreatic ductal adenocarcinomas and potentially in esophageal adenocarcinomas and gastric adenocarcinomas.
22528792 Elevated serum CA125 is associated with retroperitoneal neurofibromatosis type 1-independent malignant peripheral nerve sheath tumor
22412224 Conclude that baseline CA-125 and NT-proBNP levels are comparably reliable as heart-failure markers, and that CA-125 can be used for prognosis prediction in heart failure.
22380506 MUC16 binding to NK cells and monocytes likely contributes to tolerance of the fetal allograft from maternal responses and may also serve as a novel biomarker for preeclampsia.
22320398 we identified two specific genes, MUC16 and mesothelin, associated with the invasion process in patients with PDAC.
22286058 The current results indicate that MUC16 expression is a prognostic factor of poor survival in intrahepatic cholangiocarcinoma-mass forming type.
22284961 Serum HE4 levels were elevated less frequently than CA125 levels in benign disease, particularly in premenopausal patients.
22260844 Of various clinical and laboratory variables of systemic lupus erythematosus, only serositis is independently associated with serum CA125 elevation.
22220206 The measurement of the CA 19-9 antigen on individual proteins could improve performance over the standard CA 19-9 assay.
22159147 Data indicate that MUC16 immunopurified from pancreatic cancer cells efficiently binds E- and L- but not P-selectin.
22066010 MUC16 expression is significantly increased in pancreatic cancer and could play a potential role in the progression of this disease.
22022186 the presence of metabolic syndrome or elevated triglycerides or low high-density lipoprotein cholesterol is negatively correlated with CA-125 concentration in this cross-sectional observational study.
21893498 analysis of CA125 levels for ovarian cancer screening
21852110 CA125 (MUC16) gene silencing suppresses growth properties of ovarian and breast cancer cells
21836488 Describe CA125 immunoreactivity in 8 of 10 metastatic mucinous carcinomas arising after a diagnosis of primary ovarian mucinous carcinoma or mucinous borderline tumor of the intestinal type in which the primary neoplasms were mostly negative.
21792548 The maternal serum levels of CA 125, CEA and CA 19-9 were increased during third trimester of pregnancy, but these elevations were within the normal range.
21785467 Results suggest that MUC16 has a dual role in breast cancer cell proliferation by interacting with JAK2 and by inhibiting the apoptotic process.
21775916 Finding suggests that co-expression of mesothelin and CA125 plays a significant role in the acquisition of aggressive clinical behavior.
21625941 the combination of RECAF and CA125 serum values provides the specificity and the sensitivity necessary to screen for ovarian cancer[RECAF]
21625941 the combination of RECAF and CA125 serum values provides the specificity and the sensitivity necessary to screen for ovarian cancer
21614912 Although, postoperative CA125 decreased significantly in two weeks after tumor cytoreduction in patients with epithelial ovarian cancer, its regression did not differ according to optimal or suboptimal groups.
21601106 Study indicates that CA125 should be considered not only as a biomarker, but also as a target that can contribute to the pathogenesis and progression of epithelial ovarian cancer.
21515085 The normal range of CA 125 is a strong predictive factor for ovarian cancer recurrence even if its role in survival has not yet been determined.
21508102 MUC16 biosynthesis is posttranscriptionally regulated by Notch signaling at early stages of epithelial cell differentiation, suggesting that Notch activation contributes to maintaining a mucosal phenotype at the ocular surface
21421261 Ectopic expression of the MUC16CTD enhances SKOV3 tumor cell growth, colony formation in soft agar and enhances tumor growth and metastases in SCID mice.
21404303 The CA-125 biomarker can be used to identify chronic obstructive pulmonary disease patients with right ventricular failure.
21367474 Adding the two biomarkers CA-125 and brain natriuretic peptide increases the discriminative accuracy following acute heart failure.
21358606 CA 125 is markedly elevated in heart failure patients.
21344262 elevated CA-125 is associated with ovarian cancer.
21338226 Elevated serum CA-125 is associated with squamous cell carcinoma in cervical cancer.
21331365 Studies show that tumoral mucin-mediated ligation of the MR on infiltrating TAM may contribute to their immune suppressive phenotype.
21326240 CA125/MUC16 plays a role in epithelial-mesenchymal transition, presumably through its interaction with E-cadherin and beta-catenin complexes and by modulating EGFR and its downstream signalling pathway in NIH:OVCAR3 cells.
21280316 Serum level of CA-125 in hepatitis cirrhosis patients was correlated with lesion of liver and ascite.
21079983 TrkB protein expression in human endometrium was positively correlated with the serum CA125 and dysmenorrhea.
21046495 The MUC16 gene polymorphisms selected in this study are not involved in genetic predisposition to epithelial ovarian cancer
21046495 Observational study of gene-disease association. (HuGE Navigator)
20861755 There was a relative decrease of 18% in CA125 level after bilateral salpingo-oophorectomy. Menopausal state interacted with CA125 before and after the surgical operation.
20822954 CA125 levels might be useful for diagnosis of cardiac failure
20803207 CA-125 regression rate during pre-operative neoadjuvant chemotherapy is of independent prognostic value.
20680316 upregulated in late stage epithelial ovarian cancer
20628030 The investigation of MUC-CD-targeted T cells as a potential therapeutic approach for patients with high-risk MUC16(+) ovarian carcinomas.
20598042 The expressions of MUC1 and/or MUC16 may be available as independent prognostic factors for the endocervical type of mucinous adenocarcinoma.
20497550 MUC16-Siglec-9 binding likely mediates inhibition of anti-tumor immune responses.
20488159 The CA125-reactive fraction from placental extract was identified as carbohydrate-binding IgG.
20466443 right heart failure could increase serum levels of CA125 by hemodynamic load on the splanchnic bed containing mesothelial cells
20373053 the prognostic value of preoperative serum carbohydrate antigen19-9, carcinoembryonic antigen, and carbohydrate antigen 125 for overall survival in patients with colorectal cancer was studied
20361286 CA 125 was elevated in one third of mature and one third of immature recurrences in sacrococcygeal teratomas.
20201996 patients with elevated sCA125 levels had significantly more adverse prognostic factors at diagnosis, lower CR rates, higher relapse rates and worse survival.
20118015 CA125 expression level is significantly higher in the cervical and vaginal secretions than in the serum in women during normal reproductive period.
20099501 YKL-40 ((chitinase 3-like 1)) appears to demonstrate no advantage over CA 125 as a biomarker of ovarian cancer
20091044 Peritoneal tuberculosis may mimic a pelvic mass in imaging studies and also may increase CA-125 levels.
20090516 adenocarcinomas with MUC16 expression may have an increased risk for metastases to pleura/peritoneum but not the leptomeninges or brain
20089172 MUC16 expressing ovarian cancer cells are protected from recognition by natural killer cells.
20009886 Preoperative serum CA-125 levels were significantly higher for patients with advanced stage ovarian tumors.
20008896 Report a resected case of esophageal cyst producing CA19-9 and CA125.
19937162 serum CA 125 was significantly elevated in patients with serous ovarian tumors compared to those with endometrioid and mucinous carcinoma.
19589273 There is an important correlation between serum levels of TSGF, CA-125 and endometrial cancer.
19585675 We reported the first case of IgE myeloma with elevated level of serum CA125. To further evaluate clinical characteristics and significance of CA125 in IgE myeloma, more cases are needed.
19556244 Using the surface of the eye as a model system, Data found that galectin-3 colocalized with UC16, on the apical surface of epithelial cells and that it bound to galectin-3 affinity columns in a galactose-dependent manner.
19440066 Carbohydrate antigen-125: additional accuracy in identifying patients at risk of acute heart failure in acute coronary syndrome.
19437230 elevated in pre-eclampsia
19383238 The utility of the tumour markers carcinoembryonic antigen, cancer antigen 125, carbohydrate antigen 19-9, carbohydrate antigen 15-3, alpha-fetoprotein and human chorionic gonadotropin for the diagnosis solitary pulmonary nodules, was investigated.
19337252 Measuring CA125 serum concentrations increases the accuracy of ovarian cancer diagnosis and provides valuable information to discriminate ovarian tumours from ovarian endometriotic cysts.
19270645 Invasive micropapillary carcinoma more commonly showed immunoreactivity for MUC1, CA125, and Her2Neu compared to invasive urothelial carcinoma with retraction artifact
19122828 These results demonstrate that Sjogren's syndrome subjects display a significant increase in both soluble MUC16 and MUC16 mRNA concentrations compared to other forms of aqueous deficient dry eye and non dry-eyed individuals.
19075018 A binding domain on mesothelin for CA125/MUC16.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19060592 Serum CA125 was significantly higher in patients with ovarian cancer.
18854288 increased serum levels in a case of primary plasma cell leukemia
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
18820245 Risk of recurrence during follow-up for optimally treated advanced epithelial ovarian cancer with a low-level increase of serum CA125 levels is reported.
18797897 Women with intrauterine abortion hadsignificantly higher serum CA-125 and LDH levels compared to women with ectopic and normal intrauterine pregnancies;Ruptured tubal pregnancies resulted in significantly higher CA-125
18782111 Changes in conjunctival epithelial MUC16 and MUC5AC mRNA expression is thought to be important in the pathogenesis of atopic ocular surface disease.
18609108 Serum samples were investigated for carcinoembryonic antigen (CEA), CA125 and MUC1, alpha-foetoprotein, neuron-specific enolase and CA19.9.
18555706 Serum CA-125 levels may serve as a useful predictor of pathological outcomes in patients undergoing cystectomy for urothelial carcinoma of the bladder
18555226 Neutrophil-to-lymphocyte ratio may be used as an adjunct to CA-125 for the diagnosis of endometriosis.
18503158 evaluate the usefulness of CA-125 normalized in time area under the curve (CA-125 AUC) to signalise epithelial ovarian cancer relapse
18342144 Expression and distribution of MUC16 in conjunctival and corneal epithelial cell lines is monitored by RTPCR and immunocytochemistry.
18317225 In ovarian metastases from undiagnosed colorectal adenocarcinomas, elevated CA-125 levels and frequent coexpression of cytokeratin 7 are features that can contribute to misclassification of these metastases as primary ovarian neoplasms.
18042071 The frequency of expression of Ca125...in invasive micropapillary carcinomas...was similar to the results in unselected mammary carcinoma.
17942799 These data indicate that MUC16 is a membrane component of the nonreceptive luminal uterine surface, which prevents cell adhesion, and that its removal during uterodome formation facilitates adhesion of the trophoblast.
17852813 Results show that measurements of AFP, CEA and CA125 are more readily affected by long-term frozen storage compared with frequent freezing-thawing.
17852076 Measurement of CA 15-3 serum values in conjunction with sHER2 and CA 15-3 can increase sensitivity in metastasis detection.
17706208 A four-marker panel of CA-125, macrophage chemotactic protein-1, leptin, and macrophage migration inhibitory factor could diagnose the presence of endometriosis with 93% accuracy.
17662495 Both CA125 and brain natriuretic peptide (BNP) levels are significantly correlated with New York Heart Association (NYHA) class and outcome in patients with aortic stenosis.
17604678 MUC16 is the major [(35)S]sulphate-labelled mucin in normal human bronchial epithelial cell secretions.
17592322 This study shows that MUC1, MUC4, and MUC16 are regulated differently by dexamethasone in human corneal epithelial cells.
17449138 Overall survival was closely related with the 4-week CA125 tumor marker response.
17413979 Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features.
17301071 The CA125 change after first course of inductiion chemotherapy was independent prognostic factors for both achievement of pathological complete response and overall survival.
17300679 The most prominent delay in CA-125 decline was in patients given liposomal doxorubicin compared with those given topotecan or carboplatin.
17285443 This is th e first study to show that serum CA 125 is related to the presence and severity of heart failure and diastolic dysfunction in hypertrophic cardiomyopathy.
17211626 Results show that MUC16 is present in the whole lacrimal apparatus and its distribution pattern suggests different physiological functions with regard to tear film physiology and tear outflow.
17067392 MUC16-Mesothelin binding is a high affinity, N-glycan dependent interaction that facilitates peritoneal metastasis of ovarian tumors.
16979301 With this in mind we can hypothesize that the development of ascites was the primary cause for the elevation of CA-125 in SLE patients with nephrotic syndrome rather than the nephrotic syndrome itself.
16923563 CA125 is expressed in patients with non-Hodgkin's lymphoma but appears not to be secreted by lymphoma cells directly
16194893 Eighty-six patients (43%) had elevated CA 125 levels and 35 (17.5%) had elevated mucin 1 levels at diagnosis
16174214 CA125 is the ovarian cancer marker against which new markers for this malignancy should be judged
15599662 results showed the cell surface expression of CA125 in both adenocarcinoma and large cell carcinoma cell lines and the production of CA125 in culture medium
15016783 There was no significant difference between natural and stimulated cycles in concentrations of PP 14 and CA-125 in uterine flushings performed in the mid-luteal phase.
14676194 might contribute to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium via binding to mesothelin
12893366 A correlation has been found between CA125 expression and prognosis in renal cell carcinoma patients who underwent nephrectomy.
12734200 ovarian carcinoma antigen CA125 may induce specific immunomodulatory effects by employing its carbohydrate sequences as functional groups, thereby promoting tumor progression
12218296 The CA 125 gene: a newly discovered extension of the glycosylated N-terminal domain doubles the size of this extracellular superstructure

AA Sequence

MLKPSGLPGSSSPTRSLMTGSRSTKATPEMDSGLTGATLSPKTSTGAIVVTEHTLPFTSPDKTLASPTSS      1 - 70
VVGRTTQSLGVMSSALPESTSRGMTHSEQRTSPSLSPQVNGTPSRNYPATSMVSGLSSPRTRTSSTEGNF     71 - 140
TKEASTYTLTVETTSGPVTEKYTVPTETSTTEGDSTETPWDTRYIPVKITSPMKTFADSTASKENAPVSM    141 - 210
TPAETTVTDSHTPGRTNPSFGTLYSSFLDLSPKGTPNSRGETSLELILSTTGYPFSSPEPGSAGHSRIST    211 - 280
SAPLSSSASVLDNKISETSIFSGQSLTSPLSPGVPEARASTMPNSAIPFSMTLSNAETSAERVRSTISSL    281 - 350
GTPSISTKQTAETILTFHAFAETMDIPSTHIAKTLASEWLGSPGTLGGTSTSALTTTSPSTTLVSEETNT    351 - 420
HHSTSGKETEGTLNTSMTPLETSAPGEESEMTATLVPTLGFTTLDSKIRSPSQVSSSHPTRELRTTGSTS    421 - 490
GRQSSSTAAHGSSDILRATTSSTSKASSWTSESTAQQFSEPQHTQWVETSPSMKTERPPASTSVAAPITT    491 - 560
SVPSVVSGFTTLKTSSTKGIWLEETSADTLIGESTAGPTTHQFAVPTGISMTGGSSTRGSQGTTHLLTRA    561 - 630
TASSETSADLTLATNGVPVSVSPAVSKTAAGSSPPGGTKPSYTMVSSVIPETSSLQSSAFREGTSLGLTP    631 - 700
LNTRHPFSSPEPDSAGHTKISTSIPLLSSASVLEDKVSATSTFSHHKATSSITTGTPEISTKTKPSSAVL    701 - 770
SSMTLSNAATSPERVRNATSPLTHPSPSGEETAGSVLTLSTSAETTDSPNIHPTGTLTSESSESPSTLSL    771 - 840
PSVSGVKTTFSSSTPSTHLFTSGEETEETSNPSVSQPETSVSRVRTTLASTSVPTPVFPTMDTWPTRSAQ    841 - 910
FSSSHLVSELRATSSTSVTNSTGSALPKISHLTGTATMSQTNRDTFNDSAAPQSTTWPETSPRFKTGLPS    911 - 980
ATTTVSTSATSLSATVMVSKFTSPATSSMEATSIREPSTTILTTETTNGPGSMAVASTNIPIGKGYITEG    981 - 1050
RLDTSHLPIGTTASSETSMDFTMAKESVSMSVSPSQSMDAAGSSTPGRTSQFVDTFSDDVYHLTSREITI   1051 - 1120
PRDGTSSALTPQMTATHPPSPDPGSARSTWLGILSSSPSSPTPKVTMSSTFSTQRVTTSMIMDTVETSRW   1121 - 1190
NMPNLPSTTSLTPSNIPTSGAIGKSTLVPLDTPSPATSLEASEGGLPTLSTYPESTNTPSIHLGAHASSE   1191 - 1260
SPSTIKLTMASVVKPGSYTPLTFPSIETHIHVSTARMAYSSGSSPEMTAPGETNTGSTWDPTTYITTTDP   1261 - 1330
KDTSSAQVSTPHSVRTLRTTENHPKTESATPAAYSGSPKISSSPNLTSPATKAWTITDTTEHSTQLHYTK   1331 - 1400
LAEKSSGFETQSAPGPVSVVIPTSPTIGSSTLELTSDVPGEPLVLAPSEQTTITLPMATWLSTSLTEEMA   1401 - 1470
STDLDISSPSSPMSTFAIFPPMSTPSHELSKSEADTSAIRNTDSTTLDQHLGIRSLGRTGDLTTVPITPL   1471 - 1540
TTTWTSVIEHSTQAQDTLSATMSPTHVTQSLKDQTSIPASASPSHLTEVYPELGTQGRSSSEATTFWKPS   1541 - 1610
TDTLSREIETGPTNIQSTPPMDNTTTGSSSSGVTLGIAHLPIGTSSPAETSTNMALERRSSTATVSMAGT   1611 - 1680
MGLLVTSAPGRSISQSLGRVSSVLSESTTEGVTDSSKGSSPRLNTQGNTALSSSLEPSYAEGSQMSTSIP   1681 - 1750
LTSSPTTPDVEFIGGSTFWTKEVTTVMTSDISKSSARTESSSATLMSTALGSTENTGKEKLRTASMDLPS   1751 - 1820
PTPSMEVTPWISLTLSNAPNTTDSLDLSHGVHTSSAGTLATDRSLNTGVTRASRLENGSDTSSKSLSMGN   1821 - 1890
STHTSMTYTEKSEVSSSIHPRPETSAPGAETTLTSTPGNRAISLTLPFSSIPVEEVISTGITSGPDINSA   1891 - 1960
PMTHSPITPPTIVWTSTGTIEQSTQPLHAVSSEKVSVQTQSTPYVNSVAVSASPTHENSVSSGSSTSSPY   1961 - 2030
SSASLESLDSTISRRNAITSWLWDLTTSLPTTTWPSTSLSEALSSGHSGVSNPSSTTTEFPLFSAASTSA   2031 - 2100
AKQRNPETETHGPQNTAASTLNTDASSVTGLSETPVGASISSEVPLPMAITSRSDVSGLTSESTANPSLG   2101 - 2170
TASSAGTKLTRTISLPTSESLVSFRMNKDPWTVSIPLGSHPTTNTETSIPVNSAGPPGLSTVASDVIDTP   2171 - 2240
SDGAESIPTVSFSPSPDTEVTTISHFPEKTTHSFRTISSLTHELTSRVTPIPGDWMSSAMSTKPTGASPS   2241 - 2310
ITLGERRTITSAAPTTSPIVLTASFTETSTVSLDNETTVKTSDILDARKTNELPSDSSSSSDLINTSIAS   2311 - 2380
STMDVTKTASISPTSISGMTASSSPSLFSSDRPQVPTSTTETNTATSPSVSSNTYSLDGGSNVGGTPSTL   2381 - 2450
PPFTITHPVETSSALLAWSRPVRTFSTMVSTDTASGENPTSSNSVVTSVPAPGTWTSVGSTTDLPAMGFL   2451 - 2520
KTSPAGEAHSLLASTIEPATAFTPHLSAAVVTGSSATSEASLLTTSESKAIHSSPQTPTTPTSGANWETS   2521 - 2590
ATPESLLVVTETSDTTLTSKILVTDTILFSTVSTPPSKFPSTGTLSGASFPTLLPDTPAIPLTATEPTSS   2591 - 2660
LATSFDSTPLVTIASDSLGTVPETTLTMSETSNGDALVLKTVSNPDRSIPGITIQGVTESPLHPSSTSPS   2661 - 2730
KIVAPRNTTYEGSITVALSTLPAGTTGSLVFSQSSENSETTALVDSSAGLERASVMPLTTGSQGMASSGG   2731 - 2800
IRSGSTHSTGTKTFSSLPLTMNPGEVTAMSEITTNRLTATQSTAPKGIPVKPTSAESGLLTPVSASSSPS   2801 - 2870
KAFASLTTAPPTWGIPQSTLTFEFSEVPSLDTKSASLPTPGQSLNTIPDSDASTASSSLSKSPEKNPRAR   2871 - 2940
MMTSTKAISASSFQSTGFTETPEGSASPSMAGHEPRVPTSGTGDPRYASESMSYPDPSKASSAMTSTSLA   2941 - 3010
SKLTTLFSTGQAARSGSSSSPISLSTEKETSFLSPTASTSRKTSLFLGPSMARQPNILVHLQTSALTLSP   3011 - 3080
TSTLNMSQEEPPELTSSQTIAEEEGTTAETQTLTFTPSETPTSLLPVSSPTEPTARRKSSPETWASSISV   3081 - 3150
PAKTSLVETTDGTLVTTIKMSSQAAQGNSTWPAPAEETGSSPAGTSPGSPEMSTTLKIMSSKEPSISPEI   3151 - 3220
RSTVRNSPWKTPETTVPMETTVEPVTLQSTALGSGSTSISHLPTGTTSPTKSPTENMLATERVSLSPSPP   3221 - 3290
EAWTNLYSGTPGGTRQSLATMSSVSLESPTARSITGTGQQSSPELVSKTTGMEFSMWHGSTGGTTGDTHV   3291 - 3360
SLSTSSNILEDPVTSPNSVSSLTDKSKHKTETWVSTTAIPSTVLNNKIMAAEQQTSRSVDEAYSSTSSWS   3361 - 3430
DQTSGSDITLGASPDVTNTLYITSTAQTTSLVSLPSGDQGITSLTNPSGGKTSSASSVTSPSIGLETLRA   3431 - 3500
NVSAVKSDIAPTAGHLSQTSSPAEVSILDVTTAPTPGISTTITTMGTNSISTTTPNPEVGMSTMDSTPAT   3501 - 3570
ERRTTSTEHPSTWSSTAASDSWTVTDMTSNLKVARSPGTISTMHTTSFLASSTELDSMSTPHGRITVIGT   3571 - 3640
SLVTPSSDASAVKTETSTSERTLSPSDTTASTPISTFSRVQRMSISVPDILSTSWTPSSTEAEDVPVSMV   3641 - 3710
STDHASTKTDPNTPLSTFLFDSLSTLDWDTGRSLSSATATTSAPQGATTPQELTLETMISPATSQLPFSI   3711 - 3780
GHITSAVTPAAMARSSGVTFSRPDPTSKKAEQTSTQLPTTTSAHPGQVPRSAATTLDVIPHTAKTPDATF   3781 - 3850
QRQGQTALTTEARATSDSWNEKEKSTPSAPWITEMMNSVSEDTIKEVTSSSSVLRTLNTLDINLESGTTS   3851 - 3920
SPSWKSSPYERIAPSESTTDKEAIHPSTNTVETTGWVTSSEHASHSTIPAHSASSKLTSPVVTTSTREQA   3921 - 3990
IVSMSTTTWPESTRARTEPNSFLTIELRDVSPYMDTSSTTQTSIISSPGSTAITKGPRTEITSSKRISSS   3991 - 4060
FLAQSMRSSDSPSEAITRLSNFPAMTESGGMILAMQTSPPGATSLSAPTLDTSATASWTGTPLATTQRFT   4061 - 4130
YSEKTTLFSKGPEDTSQPSPPSVEETSSSSSLVPIHATTSPSNILLTSQGHSPSSTPPVTSVFLSETSGL   4131 - 4200
GKTTDMSRISLEPGTSLPPNLSSTAGEALSTYEASRDTKAIHHSADTAVTNMEATSSEYSPIPGHTKPSK   4201 - 4270
ATSPLVTSHIMGDITSSTSVFGSSETTEIETVSSVNQGLQERSTSQVASSATETSTVITHVSSGDATTHV   4271 - 4340
TKTQATFSSGTSISSPHQFITSTNTFTDVSTNPSTSLIMTESSGVTITTQTGPTGAATQGPYLLDTSTMP   4341 - 4410
YLTETPLAVTPDFMQSEKTTLISKGPKDVSWTSPPSVAETSYPSSLTPFLVTTIPPATSTLQGQHTSSPV   4411 - 4480
SATSVLTSGLVKTTDMLNTSMEPVTNSPQNLNNPSNEILATLAATTDIETIHPSINKAVTNMGTASSAHV   4481 - 4550
LHSTLPVSSEPSTATSPMVPASSMGDALASISIPGSETTDIEGEPTSSLTAGRKENSTLQEMNSTTESNI   4551 - 4620
ILSNVSVGAITEATKMEVPSFDATFIPTPAQSTKFPDIFSVASSRLSNSPPMTISTHMTTTQTGSSGATS   4621 - 4690
KIPLALDTSTLETSAGTPSVVTEGFAHSKITTAMNNDVKDVSQTNPPFQDEASSPSSQAPVLVTTLPSSV   4691 - 4760
AFTPQWHSTSSPVSMSSVLTSSLVKTAGKVDTSLETVTSSPQSMSNTLDDISVTSAATTDIETTHPSINT   4761 - 4830
VVTNVGTTGSAFESHSTVSAYPEPSKVTSPNVTTSTMEDTTISRSIPKSSKTTRTETETTSSLTPKLRET   4831 - 4900
SISQEITSSTETSTVPYKELTGATTEVSRTDVTSSSSTSFPGPDQSTVSLDISTETNTRLSTSPIMTESA   4901 - 4970
EITITTQTGPHGATSQDTFTMDPSNTTPQAGIHSAMTHGFSQLDVTTLMSRIPQDVSWTSPPSVDKTSSP   4971 - 5040
SSFLSSPAMTTPSLISSTLPEDKLSSPMTSLLTSGLVKITDILRTRLEPVTSSLPNFSSTSDKILATSKD   5041 - 5110
SKDTKEIFPSINTEETNVKANNSGHESHSPALADSETPKATTQMVITTTVGDPAPSTSMPVHGSSETTNI   5111 - 5180
KREPTYFLTPRLRETSTSQESSFPTDTSFLLSKVPTGTITEVSSTGVNSSSKISTPDHDKSTVPPDTFTG   5181 - 5250
EIPRVFTSSIKTKSAEMTITTQASPPESASHSTLPLDTSTTLSQGGTHSTVTQGFPYSEVTTLMGMGPGN   5251 - 5320
VSWMTTPPVEETSSVSSLMSSPAMTSPSPVSSTSPQSIPSSPLPVTALPTSVLVTTTDVLGTTSPESVTS   5321 - 5390
SPPNLSSITHERPATYKDTAHTEAAMHHSTNTAVTNVGTSGSGHKSQSSVLADSETSKATPLMSTTSTLG   5391 - 5460
DTSVSTSTPNISQTNQIQTEPTASLSPRLRESSTSEKTSSTTETNTAFSYVPTGAITQASRTEISSSRTS   5461 - 5530
ISDLDRPTIAPDISTGMITRLFTSPIMTKSAEMTVTTQTTTPGATSQGILPWDTSTTLFQGGTHSTVSQG   5531 - 5600
FPHSEITTLRSRTPGDVSWMTTPPVEETSSGFSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTSVLVT   5601 - 5670
TTNVLGTTSPEPVTSSPPNLSSPTQERLTTYKDTAHTEAMHASMHTNTAVANVGTSISGHESQSSVPADS   5671 - 5740
HTSKATSPMGITFAMGDTSVSTSTPAFFETRIQTESTSSLIPGLRDTRTSEEINTVTETSTVLSEVPTTT   5741 - 5810
TTEVSRTEVITSSRTTISGPDHSKMSPYISTETITRLSTFPFVTGSTEMAITNQTGPIGTISQATLTLDT   5811 - 5880
SSTASWEGTHSPVTQRFPHSEETTTMSRSTKGVSWQSPPSVEETSSPSSPVPLPAITSHSSLYSAVSGSS   5881 - 5950
PTSALPVTSLLTSGRRKTIDMLDTHSELVTSSLPSASSFSGEILTSEASTNTETIHFSENTAETNMGTTN   5951 - 6020
SMHKLHSSVSIHSQPSGHTPPKVTGSMMEDAIVSTSTPGSPETKNVDRDSTSPLTPELKEDSTALVMNST   6021 - 6090
TESNTVFSSVSLDAATEVSRAEVTYYDPTFMPASAQSTKSPDISPEASSSHSNSPPLTISTHKTIATQTG   6091 - 6160
PSGVTSLGQLTLDTSTIATSAGTPSARTQDFVDSETTSVMNNDLNDVLKTSPFSAEEANSLSSQAPLLVT   6161 - 6230
TSPSPVTSTLQEHSTSSLVSVTSVPTPTLAKITDMDTNLEPVTRSPQNLRNTLATSEATTDTHTMHPSIN   6231 - 6300
TAVANVGTTSSPNEFYFTVSPDSDPYKATSAVVITSTSGDSIVSTSMPRSSAMKKIESETTFSLIFRLRE   6301 - 6370
TSTSQKIGSSSDTSTVFDKAFTAATTEVSRTELTSSSRTSIQGTEKPTMSPDTSTRSVTMLSTFAGLTKS   6371 - 6440
EERTIATQTGPHRATSQGTLTWDTSITTSQAGTHSAMTHGFSQLDLSTLTSRVPEYISGTSPPSVEKTSS   6441 - 6510
SSSLLSLPAITSPSPVPTTLPESRPSSPVHLTSLPTSGLVKTTDMLASVASLPPNLGSTSHKIPTTSEDI   6511 - 6580
KDTEKMYPSTNIAVTNVGTTTSEKESYSSVPAYSEPPKVTSPMVTSFNIRDTIVSTSMPGSSEITRIEME   6581 - 6650
STFSLAHGLKGTSTSQDPIVSTEKSAVLHKLTTGATETSRTEVASSRRTSIPGPDHSTESPDISTEVIPS   6651 - 6720
LPISLGITESSNMTIITRTGPPLGSTSQGTFTLDTPTTSSRAGTHSMATQEFPHSEMTTVMNKDPEILSW   6721 - 6790
TIPPSIEKTSFSSSLMPSPAMTSPPVSSTLPKTIHTTPSPMTSLLTPSLVMTTDTLGTSPEPTTSSPPNL   6791 - 6860
SSTSHEILTTDEDTTAIEAMHPSTSTAATNVETTSSGHGSQSSVLADSEKTKATAPMDTTSTMGHTTVST   6861 - 6930
SMSVSSETTKIKRESTYSLTPGLRETSISQNASFSTDTSIVLSEVPTGTTAEVSRTEVTSSGRTSIPGPS   6931 - 7000
QSTVLPEISTRTMTRLFASPTMTESAEMTIPTQTGPSGSTSQDTLTLDTSTTKSQAKTHSTLTQRFPHSE   7001 - 7070
MTTLMSRGPGDMSWQSSPSLENPSSLPSLLSLPATTSPPPISSTLPVTISSSPLPVTSLLTSSPVTTTDM   7071 - 7140
LHTSPELVTSSPPKLSHTSDERLTTGKDTTNTEAVHPSTNTAASNVEIPSSGHESPSSALADSETSKATS   7141 - 7210
PMFITSTQEDTTVAISTPHFLETSRIQKESISSLSPKLRETGSSVETSSAIETSAVLSEVSIGATTEISR   7211 - 7280
TEVTSSSRTSISGSAESTMLPEISTTRKIIKFPTSPILAESSEMTIKTQTSPPGSTSESTFTLDTSTTPS   7281 - 7350
LVITHSTMTQRLPHSEITTLVSRGAGDVPRPSSLPVEETSPPSSQLSLSAMISPSPVSSTLPASSHSSSA   7351 - 7420
SVTSLLTPGQVKTTEVLDASAEPETSSPPSLSSTSVEILATSEVTTDTEKIHPFSNTAVTKVGTSSSGHE   7421 - 7490
SPSSVLPDSETTKATSAMGTISIMGDTSVSTLTPALSNTRKIQSEPASSLTTRLRETSTSEETSLATEAN   7491 - 7560
TVLSKVSTGATTEVSRTEAISFSRTSMSGPEQSTMSQDISIGTIPRISASSVLTESAKMTITTQTGPSES   7561 - 7630
TLESTLNLNTATTPSWVETHSIVIQGFPHPEMTTSMGRGPGGVSWPSPPFVKETSPPSSPLSLPAVTSPH   7631 - 7700
PVSTTFLAHIPPSPLPVTSLLTSGPATTTDILGTSTEPGTSSSSSLSTTSHERLTTYKDTAHTEAVHPST   7701 - 7770
NTGGTNVATTSSGYKSQSSVLADSSPMCTTSTMGDTSVLTSTPAFLETRRIQTELASSLTPGLRESSGSE   7771 - 7840
GTSSGTKMSTVLSKVPTGATTEISKEDVTSIPGPAQSTISPDISTRTVSWFSTSPVMTESAEITMNTHTS   7841 - 7910
PLGATTQGTSTLDTSSTTSLTMTHSTISQGFSHSQMSTLMRRGPEDVSWMSPPLLEKTRPSFSLMSSPAT   7911 - 7980
TSPSPVSSTLPESISSSPLPVTSLLTSGLAKTTDMLHKSSEPVTNSPANLSSTSVEILATSEVTTDTEKT   7981 - 8050
HPSSNRTVTDVGTSSSGHESTSFVLADSQTSKVTSPMVITSTMEDTSVSTSTPGFFETSRIQTEPTSSLT   8051 - 8120
LGLRKTSSSEGTSLATEMSTVLSGVPTGATAEVSRTEVTSSSRTSISGFAQLTVSPETSTETITRLPTSS   8121 - 8190
IMTESAEMMIKTQTDPPGSTPESTHTVDISTTPNWVETHSTVTQRFSHSEMTTLVSRSPGDMLWPSQSSV   8191 - 8260
EETSSASSLLSLPATTSPSPVSSTLVEDFPSASLPVTSLLNPGLVITTDRMGISREPGTSSTSNLSSTSH   8261 - 8330
ERLTTLEDTVDTEDMQPSTHTAVTNVRTSISGHESQSSVLSDSETPKATSPMGTTYTMGETSVSISTSDF   8331 - 8400
FETSRIQIEPTSSLTSGLRETSSSERISSATEGSTVLSEVPSGATTEVSRTEVISSRGTSMSGPDQFTIS   8401 - 8470
PDISTEAITRLSTSPIMTESAESAITIETGSPGATSEGTLTLDTSTTTFWSGTHSTASPGFSHSEMTTLM   8471 - 8540
SRTPGDVPWPSLPSVEEASSVSSSLSSPAMTSTSFFSTLPESISSSPHPVTALLTLGPVKTTDMLRTSSE   8541 - 8610
PETSSPPNLSSTSAEILATSEVTKDREKIHPSSNTPVVNVGTVIYKHLSPSSVLADLVTTKPTSPMATTS   8611 - 8680
TLGNTSVSTSTPAFPETMMTQPTSSLTSGLREISTSQETSSATERSASLSGMPTGATTKVSRTEALSLGR   8681 - 8750
TSTPGPAQSTISPEISTETITRISTPLTTTGSAEMTITPKTGHSGASSQGTFTLDTSSRASWPGTHSAAT   8751 - 8820
HRSPHSGMTTPMSRGPEDVSWPSRPSVEKTSPPSSLVSLSAVTSPSPLYSTPSESSHSSPLRVTSLFTPV   8821 - 8890
MMKTTDMLDTSLEPVTTSPPSMNITSDESLATSKATMETEAIQLSENTAVTQMGTISARQEFYSSYPGLP   8891 - 8960
EPSKVTSPVVTSSTIKDIVSTTIPASSEITRIEMESTSTLTPTPRETSTSQEIHSATKPSTVPYKALTSA   8961 - 9030
TIEDSMTQVMSSSRGPSPDQSTMSQDISTEVITRLSTSPIKTESTEMTITTQTGSPGATSRGTLTLDTST   9031 - 9100
TFMSGTHSTASQGFSHSQMTALMSRTPGDVPWLSHPSVEEASSASFSLSSPVMTSSSPVSSTLPDSIHSS   9101 - 9170
SLPVTSLLTSGLVKTTELLGTSSEPETSSPPNLSSTSAEILAITEVTTDTEKLEMTNVVTSGYTHESPSS   9171 - 9240
VLADSVTTKATSSMGITYPTGDTNVLTSTPAFSDTSRIQTKSKLSLTPGLMETSISEETSSATEKSTVLS   9241 - 9310
SVPTGATTEVSRTEAISSSRTSIPGPAQSTMSSDTSMETITRISTPLTRKESTDMAITPKTGPSGATSQG   9311 - 9380
TFTLDSSSTASWPGTHSATTQRFPQSVVTTPMSRGPEDVSWPSPLSVEKNSPPSSLVSSSSVTSPSPLYS   9381 - 9450
TPSGSSHSSPVPVTSLFTSIMMKATDMLDASLEPETTSAPNMNITSDESLAASKATTETEAIHVFENTAA   9451 - 9520
SHVETTSATEELYSSSPGFSEPTKVISPVVTSSSIRDNMVSTTMPGSSGITRIEIESMSSLTPGLRETRT   9521 - 9590
SQDITSSTETSTVLYKMPSGATPEVSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEI   9591 - 9660
TITTQTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRGPESLSWTSPRFVETTRSSSSL   9661 - 9730
TSLPLTTSLSPVSSTLLDSSPSSPLPVTSLILPGLVKTTEVLDTSSEPKTSSSPNLSSTSVEIPATSEIM   9731 - 9800
TDTEKIHPSSNTAVAKVRTSSSVHESHSSVLADSETTITIPSMGITSAVDDTTVFTSNPAFSETRRIPTE   9801 - 9870
PTFSLTPGFRETSTSEETTSITETSAVLYGVPTSATTEVSMTEIMSSNRIHIPDSDQSTMSPDIITEVIT   9871 - 9940
RLSSSSMMSESTQMTITTQKSSPGATAQSTLTLATTTAPLARTHSTVPPRFLHSEMTTLMSRSPENPSWK   9941 - 10010
SSLFVEKTSSSSSLLSLPVTTSPSVSSTLPQSIPSSSFSVTSLLTPGMVKTTDTSTEPGTSLSPNLSGTS  10011 - 10080
VEILAASEVTTDTEKIHPSSSMAVTNVGTTSSGHELYSSVSIHSEPSKATYPVGTPSSMAETSISTSMPA  10081 - 10150
NFETTGFEAEPFSHLTSGFRKTNMSLDTSSVTPTNTPSSPGSTHLLQSSKTDFTSSAKTSSPDWPPASQY  10151 - 10220
TEIPVDIITPFNASPSITESTGITSFPESRFTMSVTESTHHLSTDLLPSAETISTGTVMPSLSEAMTSFA  10221 - 10290
TTGVPRAISGSGSPFSRTESGPGDATLSTIAESLPSSTPVPFSSSTFTTTDSSTIPALHEITSSSATPYR  10291 - 10360
VDTSLGTESSTTEGRLVMVSTLDTSSQPGRTSSSPILDTRMTESVELGTVTSAYQVPSLSTRLTRTDGIM  10361 - 10430
EHITKIPNEAAHRGTIRPVKGPQTSTSPASPKGLHTGGTKRMETTTTALKTTTTALKTTSRATLTTSVYT  10431 - 10500
PTLGTLTPLNASMQMASTIPTEMMITTPYVFPDVPETTSSLATSLGAETSTALPRTTPSVFNRESETTAS  10501 - 10570
LVSRSGAERSPVIQTLDVSSSEPDTTASWVIHPAETIPTVSKTTPNFFHSELDTVSSTATSHGADVSSAI  10571 - 10640
PTNISPSELDALTPLVTISGTDTSTTFPTLTKSPHETETRTTWLTHPAETSSTIPRTIPNFSHHESDATP  10641 - 10710
SIATSPGAETSSAIPIMTVSPGAEDLVTSQVTSSGTDRNMTIPTLTLSPGEPKTIASLVTHPEAQTSSAI  10711 - 10780
PTSTISPAVSRLVTSMVTSLAAKTSTTNRALTNSPGEPATTVSLVTHPAQTSPTVPWTTSIFFHSKSDTT  10781 - 10850
PSMTTSHGAESSSAVPTPTVSTEVPGVVTPLVTSSRAVISTTIPILTLSPGEPETTPSMATSHGEEASSA  10851 - 10920
IPTPTVSPGVPGVVTSLVTSSRAVTSTTIPILTFSLGEPETTPSMATSHGTEAGSAVPTVLPEVPGMVTS  10921 - 10990
LVASSRAVTSTTLPTLTLSPGEPETTPSMATSHGAEASSTVPTVSPEVPGVVTSLVTSSSGVNSTSIPTL  10991 - 11060
ILSPGELETTPSMATSHGAEASSAVPTPTVSPGVSGVVTPLVTSSRAVTSTTIPILTLSSSEPETTPSMA  11061 - 11130
TSHGVEASSAVLTVSPEVPGMVTSLVTSSRAVTSTTIPTLTISSDEPETTTSLVTHSEAKMISAIPTLAV  11131 - 11200
SPTVQGLVTSLVTSSGSETSAFSNLTVASSQPETIDSWVAHPGTEASSVVPTLTVSTGEPFTNISLVTHP  11201 - 11270
AESSSTLPRTTSRFSHSELDTMPSTVTSPEAESSSAISTTISPGIPGVLTSLVTSSGRDISATFPTVPES  11271 - 11340
PHESEATASWVTHPAVTSTTVPRTTPNYSHSEPDTTPSIATSPGAEATSDFPTITVSPDVPDMVTSQVTS  11341 - 11410
SGTDTSITIPTLTLSSGEPETTTSFITYSETHTSSAIPTLPVSPGASKMLTSLVISSGTDSTTTFPTLTE  11411 - 11480
TPYEPETTAIQLIHPAETNTMVPRTTPKFSHSKSDTTLPVAITSPGPEASSAVSTTTISPDMSDLVTSLV  11481 - 11550
PSSGTDTSTTFPTLSETPYEPETTATWLTHPAETSTTVSGTIPNFSHRGSDTAPSMVTSPGVDTRSGVPT  11551 - 11620
TTIPPSIPGVVTSQVTSSATDTSTAIPTLTPSPGEPETTASSATHPGTQTGFTVPIRTVPSSEPDTMASW  11621 - 11690
VTHPPQTSTPVSRTTSSFSHSSPDATPVMATSPRTEASSAVLTTISPGAPEMVTSQITSSGAATSTTVPT  11691 - 11760
LTHSPGMPETTALLSTHPRTETSKTFPASTVFPQVSETTASLTIRPGAETSTALPTQTTSSLFTLLVTGT  11761 - 11830
SRVDLSPTASPGVSAKTAPLSTHPGTETSTMIPTSTLSLGLLETTGLLATSSSAETSTSTLTLTVSPAVS  11831 - 11900
GLSSASITTDKPQTVTSWNTETSPSVTSVGPPEFSRTVTGTTMTLIPSEMPTPPKTSHGEGVSPTTILRT  11901 - 11970
TMVEATNLATTGSSPTVAKTTTTFNTLAGSLFTPLTTPGMSTLASESVTSRTSYNHRSWISTTSSYNRRY  11971 - 12040
WTPATSTPVTSTFSPGISTSSIPSSTAATVPFMVPFTLNFTITNLQYEEDMRHPGSRKFNATERELQGLL  12041 - 12110
KPLFRNSSLEYLYSGCRLASLRPEKDSSATAVDAICTHRPDPEDLGLDRERLYWELSNLTNGIQELGPYT  12111 - 12180
LDRNSLYVNGFTHRSSMPTTSTPGTSTVDVGTSGTPSSSPSPTTAGPLLMPFTLNFTITNLQYEEDMRRT  12181 - 12250
GSRKFNTMESVLQGLLKPLFKNTSVGPLYSGCRLTLLRPEKDGAATGVDAICTHRLDPKSPGLNREQLYW  12251 - 12320
ELSKLTNDIEELGPYTLDRNSLYVNGFTHQSSVSTTSTPGTSTVDLRTSGTPSSLSSPTIMAAGPLLVPF  12321 - 12390
TLNFTITNLQYGEDMGHPGSRKFNTTERVLQGLLGPIFKNTSVGPLYSGCRLTSLRSEKDGAATGVDAIC  12391 - 12460
IHHLDPKSPGLNRERLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHRTSVPTSSTPGTSTVDLGTSGTP  12461 - 12530
FSLPSPATAGPLLVLFTLNFTITNLKYEEDMHRPGSRKFNTTERVLQTLLGPMFKNTSVGLLYSGCRLTL  12531 - 12600
LRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHWIPVPTS  12601 - 12670
STPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFK  12671 - 12740
NTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNS  12741 - 12810
LYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKF  12811 - 12880
NTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMDAICSHRLDPKSPGLNREQLYWELSQL  12881 - 12950
THGIKELGPYTLDRNSLYVNGFTHRSSVAPTSTPGTSTVDLGTSGTPSSLPSPTTAVPLLVPFTLNFTIT  12951 - 13020
NLQYGEDMRHPGSRKFNTTERVLQGLLGPLFKNSSVGPLYSGCRLISLRSEKDGAATGVDAICTHHLNPQ  13021 - 13090
SPGLDREQLYWQLSQMTNGIKELGPYTLDRNSLYVNGFTHRSSGLTTSTPWTSTVDLGTSGTPSPVPSPT  13091 - 13160
TTGPLLVPFTLNFTITNLQYEENMGHPGSRKFNITESVLQGLLKPLFKSTSVGPLYSGCRLTLLRPEKDG  13161 - 13230
VATRVDAICTHRPDPKIPGLDRQQLYWELSQLTHSITELGPYTLDRDSLYVNGFTQRSSVPTTSTPGTFT  13231 - 13300
VQPETSETPSSLPGPTATGPVLLPFTLNFTITNLQYEEDMRRPGSRKFNTTERVLQGLLMPLFKNTSVSS  13301 - 13370
LYSGCRLTLLRPEKDGAATRVDAVCTHRPDPKSPGLDRERLYWKLSQLTHGITELGPYTLDRHSLYVNGF  13371 - 13440
THQSSMTTTRTPDTSTMHLATSRTPASLSGPMTASPLLVLFTINFTITNLRYEENMHHPGSRKFNTTERV  13441 - 13510
LQGLLRPVFKNTSVGPLYSGCRLTLLRPKKDGAATKVDAICTYRPDPKSPGLDREQLYWELSQLTHSITE  13511 - 13580
LGPYTLDRDSLYVNGFTQRSSVPTTSIPGTPTVDLGTSGTPVSKPGPSAASPLLVLFTLNFTITNLRYEE  13581 - 13650
NMQHPGSRKFNTTERVLQGLLRSLFKSTSVGPLYSGCRLTLLRPEKDGTATGVDAICTHHPDPKSPRLDR  13651 - 13720
EQLYWELSQLTHNITELGPYALDNDSLFVNGFTHRSSVSTTSTPGTPTVYLGASKTPASIFGPSAASHLL  13721 - 13790
ILFTLNFTITNLRYEENMWPGSRKFNTTERVLQGLLRPLFKNTSVGPLYSGCRLTLLRPEKDGEATGVDA  13791 - 13860
ICTHRPDPTGPGLDREQLYLELSQLTHSITELGPYTLDRDSLYVNGFTHRSSVPTTSTGVVSEEPFTLNF  13861 - 13930
TINNLRYMADMGQPGSLKFNITDNVMQHLLSPLFQRSSLGARYTGCRVIALRSVKNGAETRVDLLCTYLQ  13931 - 14000
PLSGPGLPIKQVFHELSQQTHGITRLGPYSLDKDSLYLNGYNEPGPDEPPTTPKPATTFLPPLSEATTAM  14001 - 14070
GYHLKTLTLNFTISNLQYSPDMGKGSATFNSTEGVLQHLLRPLFQKSSMGPFYLGCQLISLRPEKDGAAT  14071 - 14140
GVDTTCTYHPDPVGPGLDIQQLYWELSQLTHGVTQLGFYVLDRDSLFINGYAPQNLSIRGEYQINFHIVN  14141 - 14210
WNLSNPDPTSSEYITLLRDIQDKVTTLYKGSQLHDTFRFCLVTNLTMDSVLVTVKALFSSNLDPSLVEQV  14211 - 14280
FLDKTLNASFHWLGSTYQLVDIHVTEMESSVYQPTSSSSTQHFYLNFTITNLPYSQDKAQPGTTNYQRNK  14281 - 14350
RNIEDALNQLFRNSSIKSYFSDCQVSTFRSVPNRHHTGVDSLCNFSPLARRVDRVAIYEEFLRMTRNGTQ  14351 - 14420
LQNFTLDRSSVLVDGYSPNRNEPLTGNSDLPFWAVILIGLAGLLGVITCLICGVLVTTRRRKKEGEYNVQ  14421 - 14490
QQCPGYYQSHLDLEDLQ                                                       14491 - 14507
//

Text Mined References (210)

PMID Year Title
26770020 2015 Differential Expression of MUC12, MUC16, and MUC20 in Patients with Active and Remission Ulcerative Colitis.
26329844 2015 Distinct kinetic and mechanical properties govern mucin 16- and podocalyxin-mediated tumor cell adhesion to E- and L-selectin in shear flow.
26285075 2016 Modification of cut-off values for HE4, CA125 and the ROMA algorithm for early-stage epithelial ovarian cancer detection: Results from 1021 cases in South China.
26246541 2015 Diagnostic value of serum CA125, CA19-9 and CA15-3 in endometriosis: A meta-analysis.
26176088 2014 Prognostic Value of Preoperative Serum Levels of Five Tumor Markers (Carcinoembryonic Antigen, CA19-9, Alpha-fetoprotein, CA72-4, and CA125) in Gastric Cancer.
26163610 2015 Clinical Evaluation of Tumor Markers for Diagnosis in Patients with Non-small Cell Lung Cancer in China.
26143638 2015 Vascular endothelial growth factor expression correlates with serum CA125 and represents a useful tool in prediction of refractoriness to platinum-based chemotherapy and ascites formation in epithelial ovarian cancer.
26122176 2015 Inflammation-regulating factors in ascites as predictive biomarkers of drug resistance and progression-free survival in serous epithelial ovarian cancers.
26046375 2015 MUC16-mediated activation of mTOR and c-Myc reprograms pancreatic cancer metabolism.
26045023 2015 The Risk of Ovarian Malignancy Algorithm (ROMA) as a Predictive Marker of Peritoneal Dissemination in Epithelial Ovarian Cancer Patients.
25978292 2015 The Value of Serum CA125 in the Diagnosis of Borderline Tumors of the Ovary: A Subanalysis of the Prospective Multicenter ROBOT Study.
25968305 2015 Carbohydrate antigen 125 levels and clinical outcomes after off-pump coronary artery bypass grafting.
25967705 2015 Analysis of laparoscopy on endometriosis patients with high expression of CA125.
25965947 2015 Expression of the Carboxy-Terminal Portion of MUC16/CA125 Induces Transformation and Tumor Invasion.
25951715 2015 Novel markers in the diagnostics of endometriomas: Urocortin, ghrelin, and leptin or leukocytes, fibrinogen, and CA-125?
25891047 2015 Cellular leiomyoma with necrosis and mucinous degeneration presenting as pseudo-Meigs' syndrome with elevated CA125.
25875367 2015 Prognostic value of the interaction between galectin-3 and antigen carbohydrate 125 in acute heart failure.
25834501 2014 Serum HE4 is more suitable as a biomarker than CA125 in Chinese women with benign gynecologic disorders.
25799488 2015 Validation of LRG1 as a potential biomarker for detection of epithelial ovarian cancer by a blinded study.
25691062 2015 Carboxyl-terminal domain of MUC16 imparts tumorigenic and metastatic functions through nuclear translocation of JAK2 to pancreatic cancer cells.
25667483 2015 Claudin-5 is associated with elevated TATI and CA125 levels in mucinous ovarian borderline tumors.
25577553 2015 Usefulness of CA125 in the differential diagnosis of uterine adenomyosis and myoma.
25563498 2015 Suppression of Toll-like receptor-mediated innate immune responses at the ocular surface by the membrane-associated mucins MUC1 and MUC16.
25531720 2014 Analysis of the discriminative methods for diagnosis of benign and malignant solitary pulmonary nodules based on serum markers.
25458668 Combination of cyst fluid CEA and CA 125 is an accurate diagnostic tool for differentiating mucinous cystic neoplasms from intraductal papillary mucinous neoplasms.
25454345 2015 Detection of glyco-mucin profiles improves specificity of MUC16 and MUC1 biomarkers in ovarian serous tumours.
25416055 2014 Significant simultaneous changes in serum CA19-9 and CA125 due to prolonged torsion of mature cystic teratoma of the ovary.
25344872 2014 Prognostic value of carbohydrate tumor markers and inflammation-based markers in metastatic or recurrent gastric cancer.
25326813 2015 Evaluation of human epididymis protein 4 (HE4) and Risk of Ovarian Malignancy Algorithm (ROMA) as diagnostic tools of type I and type II epithelial ovarian cancer in Japanese women.
25279712 2014 Immunohistochemical distinction of renal cell carcinoma from other carcinomas with clear-cell histomorphology: utility of CD10 and CA-125 in addition to PAX-2, PAX-8, RCCma, and adipophilin.
25256054 2015 Cancer antigen 125 levels and increased risk of new-onset atrial fibrillation.
25217152 2014 Diagnostic and prognostic role of peritoneal CA 125 in peritoneal dialysis patients presenting with acute peritonitis.
25205731 2014 Membrane-type I matrix metalloproteinase-dependent ectodomain shedding of mucin16/ CA-125 on ovarian cancer cells modulates adhesion and invasion of peritoneal mesothelium.
25197000 2015 Difference in mesothelin-binding ability of serum CA125 between patients with endometriosis and epithelial ovarian cancer.
25190018 2014 Serum HE4 and CA125 as predictors of response and outcome during neoadjuvant chemotherapy of advanced high-grade serous ovarian cancer.
25174623 2014 Thioredoxin 1 as a serum marker for ovarian cancer and its use in combination with CA125 for improving the sensitivity of ovarian cancer diagnoses.
25118488 2014 Is HE4 a useful endometrioma marker?
25048447 2015 3D origami electrochemical immunodevice for sensitive point-of-care testing based on dual-signal amplification strategy.
24968021 2014 Comparison of the transmembrane mucins MUC1 and MUC16 in epithelial barrier function.
24939955 2014 Expression of the transmembrane mucins, MUC1, MUC4 and MUC16, in normal endometrium and in endometriosis.
24913812 2014 Serum CA125 level predicts prognosis in patients with multiple brain metastases from non-small cell lung cancer before and after treatment of whole-brain radiotherapy.
24879526 2014 Nipple discharge of CA15-3, CA125, CEA and TSGF as a new biomarker panel for breast cancer.
24831034 2015 Clinical and prognostic value of elevated CA125 levels in patients with coronary heart disease.
24812549 2014 Effects of the loss of conjunctival Muc16 on corneal epithelium and stroma in mice.
24779300 2014 Cancer antigen-125 and ICAM-1 are together responsible for ascites in liver cirrhosis.
24771264 2014 HE4, Ca125 and ROMA algorithm for differential diagnosis between benign gynaecological diseases and ovarian cancer.
24740561 2014 May increased CA125 in borderline ovarian tumor be indicative of a poor prognosis? A case report.
24722639 2014 Pathobiological implications of mucin (MUC) expression in the outcome of small bowel cancer.
24716917 2014 Modification of cutoff values for HE4, CA125, the Risk of Malignancy Index, and the Risk of Malignancy Algorithm for ovarian cancer detection in Jakarta, Indonesia.
24690311 2014 MUC16 mucin (CA125) attenuates TRAIL-induced apoptosis by decreasing TRAIL receptor R2 expression and increasing c-FLIP expression.
24680660 2014 Precystectomy serum levels of carbohydrate antigen 19-9, carbohydrate antigen 125, and carcinoembryonic antigen: prognostic value in invasive urothelial carcinoma of the bladder.
24659664 The prognostic role of preoperative serum CA 125 levels in patients with endometrial carcinoma.
24651630 2014 Using serum CA125 to assess the activity of potential cytostatic agents in ovarian cancer.
24642341 2014 Serum CA125 and NSE: biomarkers of disease severity in patients with silicosis.
24551091 2014 Polymorphisms of MUC16 (CA125) and MUC1 (CA15.3) in relation to ovarian cancer risk and survival.
24447304 2014 Novel treatment option for MUC16-positive malignancies with the targeted TRAIL-based fusion protein Meso-TR3.
24403483 2014 CA125 and HE4 levels in a Czech female population diagnosed with endometrial cancer in preoperative management.
24359057 2014 Severe adenomyosis and CA125.
24339876 2013 BMPR1B up-regulation via a miRNA binding site variation defines endometriosis susceptibility and CA125 levels.
24246580 CA125/MUC16 interacts with Src family kinases, and over-expression of its C-terminal fragment in human epithelial cancer cells reduces cell-cell adhesion.
24204560 2013 MicroRNA-200c modulates the expression of MUC4 and MUC16 by directly targeting their coding sequences in human pancreatic cancer.
24083699 2013 Pattern of tissue expression of CA-125 and HE4 in primary epithelial ovarian tumours and correlation with serum CA-125 levels.
24060730 2013 Elevation of carbohydrate antigen 125 in chronic heart failure may be caused by mechanical extension of mesothelial cells from serous cavity effusion.
24039759 2013 Glycan elongation beyond the mucin associated Tn antigen protects tumor cells from immune-mediated killing.
24012857 2013 The reference intervals for HE4, CA125 and ROMA in healthy female with electrochemiluminescence immunoassay.
23925696 2013 Puerperal mastitis: a reproductive event of importance affecting anti-mucin antibody levels and ovarian cancer risk.
23915849 2013 Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels.
23886210 2013 Expression and significance of ER, PR, VEGF, CA15-3, CA125 and CEA in judging the prognosis of breast cancer.
23765208 2013 CA125 level association with chemotherapy toxicity and functional status in older women with ovarian cancer.
23712355 2013 Prognostic value of tumor markers, NSE, CA125 and SCC, in operable NSCLC Patients.
23702013 2013 Tumor marker carbohydrate antigen 125 predicts adverse outcome after transcatheter aortic valve implantation.
23687433 2013 Quantification of MUCIN 1, cell surface associated and MUCIN16, cell surface associated proteins in tears and conjunctival epithelial cells collected from postmenopausal women.
23669443 2013 CA-125 level as a prognostic indicator in type I and type II epithelial ovarian cancer.
23643288 2013 Tumor marker levels in patients aged 85 years and older with chronic heart failure.
23613350 Saliva CA125 and TPS levels in patients with oral squamous cell carcinoma.
23575338 2013 Pleural cancer antigen-125 levels in benign and malignant pleural effusions.
23568007 2012 Serum carbohydrate antigen 125 is not an independent prognostic factor in patients with chronic lymphocytic leukemia.
23564055 2013 Vascular endothelial growth factor (VEGF) improves the sensitivity of CA125 for differentiation of epithelial ovarian cancers from ovarian cysts.
23560726 2013 The inverse relation of CA-125 to diabetes, metabolic syndrome, and associated clinical variables.
23544943 2013 Immunocytochemistry for MUC4 and MUC16 is a useful adjunct in the diagnosis of pancreatic adenocarcinoma on fine-needle aspiration cytology.
23426716 2013 Serum human epididymis protein 4 vs carbohydrate antigen 125 for ovarian cancer diagnosis: a systematic review.
23414674 2013 The clinical significance of CA-125 in pulmonary tuberculosis.
23357461 2013 Does CA125 binding to mesothelin impact the detection of malignant mesothelioma?
23343214 2013 Significance of HE4 estimation in comparison with CA125 in diagnosis of ovarian cancer and assessment of treatment response.
23322523 2013 Assessment of CA-125 area under the curve as a prognostic factor in patients with ovarian cancer.
23168398 2013 Identification of an atypical zinc metalloproteinase, ZmpC, from an epidemic conjunctivitis-causing strain of Streptococcus pneumoniae.
23095772 2012 The prognostic and predictive value of combined HE4 and CA-125 in ovarian cancer patients.
23053434 2012 Microbial products alter the expression of membrane-associated mucin and antimicrobial peptides in a three-dimensional human endocervical epithelial cell model.
22994745 2012 Proteomic analysis of serum of women with elevated Ca-125 to differentiate malignant from benign ovarian tumors.
22941175 2013 Significance of serum tumor marker levels in peritoneal carcinomatosis of appendiceal origin.
22727919 2012 Preoperative serum CA 125 level in the prediction of the stage of disease in endometrial carcinoma.
22674301 The prognostic values of CA125, CA19.9, NSE, AND SCC for stage I NSCLC are limited.
22639051 2012 High serum carbohydrate antigen-125 (CA-125) level predicts poor outcome in patients with follicular lymphoma independently of the FLIPI score.
22542127 2012 Mucin 16 (cancer antigen 125) expression in human tissues and cell lines and correlation with clinical outcome in adenocarcinomas of the pancreas, esophagus, stomach, and colon.
22528792 2012 A retroperitoneal NF1-independent malignant peripheral nerve sheath tumor with elevated serum CA125: case report and discussion.
22412224 2012 Carbohydrate antigen-125 and N-terminal pro-brain natriuretic peptide levels: compared in heart-failure prognostication.
22380506 2012 The mucin MUC16 (CA125) binds to NK cells and monocytes from peripheral blood of women with healthy pregnancy and preeclampsia.
22320398 2012 Coexpression of MUC16 and mesothelin is related to the invasion process in pancreatic ductal adenocarcinoma.
22286058 2012 Pathobiological implications of MUC16/CA125 expression in intrahepatic cholangiocarcinoma-mass forming type.
22284961 2012 Serum HE4 levels are less frequently elevated than CA125 in women with benign gynecologic disorders.
22260844 Serum CA125 elevation is independently associated with serositis in SLE patients.
22220206 2011 Enhanced discrimination of malignant from benign pancreatic disease by measuring the CA 19-9 antigen on specific protein carriers.
22159147 2012 Mucin 16 is a functional selectin ligand on pancreatic cancer cells.
22066010 2011 Pathobiological implications of MUC16 expression in pancreatic cancer.
22022186 2011 Serum CA125 concentration has inverse correlation with metabolic syndrome.
21893498 2011 Personalizing CA125 levels for ovarian cancer screening.
21852110 2012 CA125 (MUC16) gene silencing suppresses growth properties of ovarian and breast cancer cells.
21836488 2011 Emergence of CA125 immunoreactivity in recurrent or metastatic primary ovarian mucinous neoplasms of the intestinal type.
21792548 2012 Serum concentrations of CA 125, CA 15-3, CA 19-9 and CEA in normal pregnancy: a longitudinal study.
21785467 2012 MUC16 induced rapid G2/M transition via interactions with JAK2 for increased proliferation and anti-apoptosis in breast cancer cells.
21775916 2011 Co-expression of mesothelin and CA125 correlates with unfavorable patient outcome in pancreatic ductal adenocarcinoma.
21625941 2011 Combination of CA125 and RECAF biomarkers for early detection of ovarian cancer.
21614912 2011 Is postoperative CA125 level in patients with epithelial ovarian cancer reliable to guess the optimality of surgery?
21601106 2011 More than a biomarker: CA125 may contribute to ovarian cancer pathogenesis.
21515085 2011 [Interest of CA 125 level in management of ovarian cancer].
21508102 2011 Notch signaling modulates MUC16 biosynthesis in an in vitro model of human corneal and conjunctival epithelial cell differentiation.
21421261 2011 MUC16 (CA125) regulates epithelial ovarian cancer cell growth, tumorigenesis and metastasis.
21404303 2011 Role of CA-125 in identification of right ventricular failure in chronic obstructive pulmonary disease.
21367474 2012 Antigen carbohydrate 125 and brain natriuretic peptide serial measurements for risk stratification following an episode of acute heart failure.
21358606 2011 Relationship between pro-anti-inflammatory cytokines, T-cell activation and CA 125 in obese patients with heart failure.
21344262 2011 Prognostic and predictive relevance of CA-125 at primary surgery of ovarian cancer.
21338226 2010 Squamous cell carcinoma antigen and cancer antigen 125 in southern Indian cervical cancer patients.
21331365 2010 Engagement of the mannose receptor by tumoral mucins activates an immune suppressive phenotype in human tumor-associated macrophages.
21326240 2011 Downregulation of cell surface CA125/MUC16 induces epithelial-to-mesenchymal transition and restores EGFR signalling in NIH:OVCAR3 ovarian carcinoma cells.
21280316 2010 [Evaluation on clinical value of serum CA-125 level in hepatitis cirrhosis].
21079983 2011 Expression of tyrosine kinase receptor B in eutopic endometrium of women with adenomyosis.
21046495 2011 Polymorphisms in the MUC16 gene: potential implication in epithelial ovarian cancer.
20861755 2011 Cancer antigen 125 level after a bilateral salpingo-oophorectomy: what is the contribution of the ovary to the cancer antigen 125 level?
20822954 2011 CA125--a test with a change of heart.
20803207 2011 The prognostic and predictive value of CA-125 regression during neoadjuvant chemotherapy for advanced ovarian or primary peritoneal carcinoma.
20680316 2011 The association with age, human tissue kallikreins 6 and 10 and hemostatic markers for survival outcome from epithelial ovarian cancer.
20628030 2010 Successful eradication of established peritoneal ovarian tumors in SCID-Beige mice following adoptive transfer of T cells genetically targeted to the MUC16 antigen.
20598042 2010 Expression of mucin antigens (MUC1 and MUC16) as a prognostic factor for mucinous adenocarcinoma of the uterine cervix.
20497550 2010 Identification of Siglec-9 as the receptor for MUC16 on human NK cells, B cells, and monocytes.
20488159 2010 Identification of pregnancy-associated CA125-reactive protein as a carbohydrate-binding immunoglobulin G.
20466443 2010 Association of right heart with CA-125 levels in patients with heart failure.
20373053 2011 Preoperative serum carbohydrate antigen 125 level is an independent negative prognostic marker for overall survival in colorectal cancer.
20361286 2010 Tumor markers AFP, CA 125, and CA 19-9 in the long-term follow-up of sacrococcygeal teratomas in infancy and childhood.
20201996 2010 Prognostic value of serum CA125 levels in diffuse large B-cell lymphoma: potential role of a new sex- and age-adjusted reference value.
20118015 2010 [CA 125 expression in cervical and vaginal secretions in women in normal reproductive period].
20099501 2009 Serum YKL-40 levels in patients with ovarian cancer and women with BRCA1 gene mutation--comparison to CA 125 antigen.
20091044 2010 Peritoneal tuberculosis in premenopausal patients with elevated serum CA 125.
20090516 2010 MUC16 expression and risk of adenocarcinoma metastases to peritoneum, pleura, leptomeninges, and brain.
20089172 2010 MUC16 provides immune protection by inhibiting synapse formation between NK and ovarian tumor cells.
20009886 2009 Preoperative CA-125 levels in 123 patients with borderline ovarian tumors: a retrospective analysis and review of the literature.
20008896 2010 Esophageal cyst producing CA19-9 and CA125.
19937162 2010 Clinical utility of circulating matrix metalloproteinase-7 (MMP-7), CC chemokine ligand 18 (CCL18) and CC chemokine ligand 11 (CCL11) as markers for diagnosis of epithelial ovarian cancer.
19589273 Clinical value of tumour specific growth factor (TSGF) and carbohydrate antigen-125 (CA-125) in carcinoma of the endometrium.
19585675 2009 IgE myeloma with elevated level of serum CA125.
19556244 2009 Association of cell surface mucins with galectin-3 contributes to the ocular surface epithelial barrier.
19440066 2009 Carbohydrate antigen-125: additional accuracy in identifying patients at risk of acute heart failure in acute coronary syndrome.
19437230 2009 CA-125 and CRP are elevated in preeclampsia.
19383238 The efficacy of serum carcinoembryonic antigen (CEA), cancer antigen 125 (CA125), carbohydrate antigen 19-9 (CA19-9), carbohydrate antigen 15-3 (CA15-3), alpha-fetoprotein (AFP) and human chorionic gonadotropin (hCG) levels in determining the malignancy of solitary pulmonary nodules.
19337252 2009 Serum HE4 concentration differentiates malignant ovarian tumours from ovarian endometriotic cysts.
19270645 2009 Immunohistochemical comparison of MUC1, CA125, and Her2Neu in invasive micropapillary carcinoma of the urinary tract and typical invasive urothelial carcinoma with retraction artifact.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19122828 2008 MUC16 expression in Sjogren's syndrome, KCS, and control subjects.
19075018 2009 A binding domain on mesothelin for CA125/MUC16.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19060592 2008 Statistical interpretation of CA125 and Bcl-2 in serum of patients with late stage ovarian cancer.
18854288 2008 Increased serum tumor markers (CA125 and CA15.3) in primary plasma cell leukemia: a case report and review of the literature.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
18820245 2009 Risk of recurrence during follow-up for optimally treated advanced epithelial ovarian cancer (EOC) with a low-level increase of serum CA-125 levels.
18797897 2009 Predictive power of serum CA-125 and LDH in the outcome of first trimester pregnancies with human chorionic gonadotropin levels below discriminatory zone.
18782111 2008 Alterations of the ocular surface epithelial MUC16 and goblet cell MUC5AC in patients with atopic keratoconjunctivitis.
18609108 2008 Reference intervals for carcinoembryonic antigen (CEA), CA125, MUC1, Alfa-foeto-protein (AFP), neuron-specific enolase (NSE) and CA19.9 from the NORIP study.
18555706 Clinical use of serum CA-125 levels in patients undergoing radical cystectomy for transitional cell carcinoma of the bladder.
18555226 2008 Neutrophil-to-lymphocyte ratio as an adjunct to CA-125 for the diagnosis of endometriosis.
18503158 2008 CA-125 AUC as a predictor for epithelial ovarian cancer relapse.
18342144 2008 Regulation of MUC16 by inflammatory mediators in ocular surface epithelial cell lines.
18317225 2008 Women with undiagnosed colorectal adenocarcinomas presenting with ovarian metastases: clinicopathologic features and comparison with women having known colorectal adenocarcinomas and ovarian involvement.
18042071 2007 The expression of Wilms' tumour-1 and Ca125 in invasive micropapillary carcinoma of the breast.
17942799 2008 MUC16 is lost from the uterodome (pinopode) surface of the receptive human endometrium: in vitro evidence that MUC16 is a barrier to trophoblast adherence.
17852813 2007 Effect of freeze-thaw cycles on serum measurements of AFP, CEA, CA125 and CA19-9.
17852076 Clinical evaluation of the simultaneous determination of CA 15-3, CA 125 and sHER2 in breast cancer.
17706208 2008 Panel of markers can accurately predict endometriosis in a subset of patients.
17662495 2008 Heart failure in patients with aortic stenosis: clinical and prognostic significance of carbohydrate antigen 125 and brain natriuretic peptide measurement.
17604678 2007 MUC16 is produced in tracheal surface epithelium and submucosal glands and is present in secretions from normal human airway and cultured bronchial epithelial cells.
17592322 2007 Regulation of membrane-associated mucins in the human corneal epithelial cells by dexamethasone.
17449138 2007 Serum tumor markers as predictors for survival in advanced non-small cell lung cancer patients treated with gefitinib.
17413979 2007 Carcinomas of ovary and lung with clear cell features: can immunohistochemistry help in differential diagnosis?
17301071 2007 Change in CA 125 levels after the first cycle of induction chemotherapy is an independent predictor of epithelial ovarian tumour outcome.
17300679 Early CA-125 fluctuations in patients with recurrent ovarian cancer receiving chemotherapy.
17285443 2007 Elevated carbohydrate antigen 125 levels in hypertrophic cardiomyopathy patients with heart failure.
17211626 2007 MUC16 in the lacrimal apparatus.
17067392 2006 Mesothelin-MUC16 binding is a high affinity, N-glycan dependent interaction that facilitates peritoneal metastasis of ovarian tumors.
16979301 2007 Ascites is the primary cause of cancer antigen-125 (CA-125) elevation in systemic lupus erythematosus (SLE) patients with nephrotic syndrome.
16923563 2006 CA125 expression in patients with non-Hodgkin's lymphoma.
16384952 2006 Mucin characteristics of human corneal-limbal epithelial cells that exclude the rose bengal anionic dye.
16194893 2005 Usefulness of tumor markers CA 125 and CA 15.3 at diagnosis and during follow-up in non-Hodgkin's lymphoma: study of 200 patients.
16174214 CA125 in ovarian cancer: European Group on Tumor Markers guidelines for clinical use.
15788735 2005 Introducing the MUC16 gene: implications for prevention and early detection in epithelial ovarian cancer.
15599662 2004 Production of CA125 by human lung cancer cell lines.
15483748 2004 Detection of tumor marker CA125 in ovarian carcinoma using quantum dots.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15016783 2004 Concentrations of endometrial protein PP 14 and CA-125 in uterine flushings performed in natural and stimulated cycles.
14764598 2004 Solution structure of the SEA domain from the murine homologue of ovarian cancer antigen CA125 (MUC16).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676194 2004 Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.
14566828 2003 Clinical value of p53, c-erbB-2, CEA and CA125 regarding relapse, metastasis and death in resectable non-small cell lung cancer.
12893366 2003 Prognostic significance of CA 125, CD44, and epithelial membrane antigen in renal cell carcinoma.
12766047 2003 MUC16 mucin is expressed by the human ocular surface epithelia and carries the H185 carbohydrate epitope.
12734200 2003 Characterization of the oligosaccharides associated with the human ovarian tumor marker CA125.
12218296 The CA 125 gene: a newly discovered extension of the glycosylated N-terminal domain doubles the size of this extracellular superstructure.
11920644 2002 Ovarian cancer antigen CA125 is encoded by the MUC16 mucin gene.
11786729 The CA 125 gene: an extracellular superstructure dominated by repeat sequences.
11369781 2001 Molecular cloning of the CA125 ovarian cancer antigen: identification as a new mucin, MUC16.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9276028 1997 CA125 phosphorylation is associated with its secretion from the WISH human amnion cell line.