Property Summary

NCBI Gene PubMed Count 30
PubMed Score 64.24
PubTator Score 49.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
acute quadriplegic myopathy -1.034 2.3e-02
adult high grade glioma -1.200 4.6e-02
aldosterone-producing adenoma -1.124 3.1e-02
atypical teratoid / rhabdoid tumor -1.500 2.1e-03
autosomal dominant Emery-Dreifuss muscul... -1.706 7.8e-03
cystic fibrosis -1.043 2.9e-03
dermatomyositis -1.200 5.2e-03
Down syndrome 1.700 6.2e-04
ependymoma -1.300 1.7e-06
glioblastoma -1.200 6.9e-03
hereditary spastic paraplegia -1.343 1.9e-03
intraductal papillary-mucinous adenoma (... 1.400 1.9e-04
intraductal papillary-mucinous carcinoma... 1.500 7.3e-04
intraductal papillary-mucinous neoplasm ... -1.100 4.3e-02
limb girdle muscular dystrophy 2A -1.204 3.5e-03
lung adenocarcinoma 1.082 6.9e-04
lung cancer -1.900 6.5e-03
malignant mesothelioma -1.800 2.7e-06
medulloblastoma, large-cell -1.800 9.7e-03
Multiple myeloma 1.241 1.8e-02
osteosarcoma 2.258 1.1e-03
ovarian cancer -1.100 3.0e-12
pancreatic cancer -1.200 6.8e-03
pancreatic ductal adenocarcinoma liver m... 1.206 7.1e-04
Pick disease 1.100 4.6e-03
progressive supranuclear palsy -1.200 1.6e-02
psoriasis -1.300 6.0e-09
sonic hedgehog group medulloblastoma -1.400 2.7e-02
spina bifida -1.110 3.6e-02
subependymal giant cell astrocytoma -2.599 1.0e-02
urothelial carcinoma -1.100 2.0e-02

Protein-protein Interaction (1)

Gene RIF (26)

AA Sequence

MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDYETDPAVVTGENI      1 - 70
SLSLQGVEVFGHEKSSSDFISKQVLDMHKDSICQCPALVGTEKPKYLQHSCHSLEAVEGQSVEPSLPFVW     71 - 140
KPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGKSQSFHTAGSLPPTGRRSGSTSSLSYSTWTS    141 - 210
SHSDKTHARETTYDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGKVTSEYTDGSQ    211 - 280
QRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDEC    281 - 350
PLMVPAFDKSEAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVI    351 - 420
STDKTMCMSTPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPI    421 - 490
GCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSASSPSSVNSRQQTVLSRTPRSD    491 - 560
LNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV    561 - 630
SALFQKIKGILPVKMESAECLEMTYVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFEYGSLFLGSA    631 - 700
SKTTTTSGRNISKPDSCGLRQIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGKPTSLKT    701 - 770
AQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNSGNAAVIKYEEKPPKPAFQNGSSG    771 - 840
SFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNAVEKSRQKNPRSLCIQPQTAPDALPPEKTLELTQYKT    841 - 910
KCENQSGFILQLKQLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTASTTCEKLEK    911 - 980
ARNELQTVYEAFVQQHQAEKTERENRLKEFYTREYEKLRDTYIEEAEKYKMQLQEQFDNLNAAHETSKLE    981 - 1050
IEASHSEKLELLKKAYEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKR   1051 - 1120
RAREKANLKNPQIMYLEQELESLKAVLEIKNEKLHQQDIKLMKMEKLVDNNTALVDKLKRFQQENEELKA   1121 - 1190
RMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG   1191 - 1260
SFPSPSISPR                                                               1261 - 1270
//

Text Mined References (43)

PMID Year Title