Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.61
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute myeloid leukemia -1.100 3.1e-02
adult high grade glioma -2.400 1.0e-05
Astrocytoma, Pilocytic -2.300 3.4e-09
atypical teratoid / rhabdoid tumor -3.900 1.2e-07
autosomal dominant Emery-Dreifuss muscul... 1.119 2.4e-03
Breast cancer -1.100 8.3e-07
breast carcinoma -1.800 3.8e-04
chronic rhinosinusitis -1.151 1.3e-02
cystic fibrosis 1.094 1.8e-05
Duchenne muscular dystrophy 1.031 5.7e-06
ductal carcinoma in situ -2.300 3.6e-04
fibroadenoma -1.700 2.0e-02
glioblastoma -2.100 5.9e-06
group 3 medulloblastoma -1.200 2.7e-03
interstitial cystitis -1.300 3.9e-03
invasive ductal carcinoma -3.500 1.3e-04
lung adenocarcinoma -2.200 4.2e-10
medulloblastoma, large-cell -2.200 2.3e-03
non-small cell lung cancer -1.977 4.6e-27
osteosarcoma -3.024 2.1e-03
ovarian cancer -1.600 6.6e-08
pancreatic cancer 1.600 1.2e-04
pancreatic carcinoma 1.600 1.2e-04
primitive neuroectodermal tumor -1.400 2.6e-03
psoriasis -1.200 2.2e-29
subependymal giant cell astrocytoma -2.358 1.1e-02

Gene RIF (1)

AA Sequence

MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLA      1 - 70
QDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ              71 - 131
//

Text Mined References (10)

PMID Year Title