Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.61
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer 1.600 1.2e-04
glioblastoma -3.000 1.3e-04
osteosarcoma -3.024 2.1e-03
medulloblastoma -1.600 4.7e-06
cystic fibrosis -1.200 6.3e-05
atypical teratoid / rhabdoid tumor -3.900 1.2e-07
medulloblastoma, large-cell -2.200 2.3e-03
primitive neuroectodermal tumor -1.400 2.6e-03
Duchenne muscular dystrophy 1.031 5.7e-06
autosomal dominant Emery-Dreifuss muscul... 1.119 2.4e-03
non-small cell lung cancer -1.977 4.6e-27
breast carcinoma -1.800 3.8e-04
fibroadenoma -1.700 2.0e-02
interstitial cystitis -1.300 3.9e-03
pediatric high grade glioma -2.600 5.5e-06
pilocytic astrocytoma -2.300 3.3e-09
pancreatic carcinoma 1.600 1.2e-04
acute myeloid leukemia -1.100 3.1e-02
psoriasis -1.200 2.2e-29
subependymal giant cell astrocytoma -2.358 1.1e-02
lung adenocarcinoma -2.200 4.2e-10
non-inflammatory breast cancer -1.800 6.9e-03
ductal carcinoma in situ -2.300 3.6e-04
invasive ductal carcinoma -3.500 1.3e-04
ovarian cancer -1.600 6.6e-08
chronic rhinosinusitis -1.151 1.3e-02

Synonym

Accession Q8N3F0 B8ZZW9 Q8N791 Q8N8M4 Q8NEX2
Symbols Ells1
C7orf41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLA      1 - 70
QDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ              71 - 131
//

Text Mined References (10)

PMID Year Title
24681962 2014 Novel function of the chromosome 7 open reading frame 41 gene to promote leukemic megakaryocyte differentiation by modulating TPA-induced signaling.
24095902 2013 Maturin is a novel protein required for differentiation during primary neurogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.