Property Summary

NCBI Gene PubMed Count 52
PubMed Score 495.82
PubTator Score 119.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer -1.200 5.8e-03
malignant mesothelioma -1.200 1.4e-05
oligodendroglioma 1.400 1.0e-02
esophageal adenocarcinoma -1.400 4.4e-02
group 4 medulloblastoma 2.900 1.5e-05
cystic fibrosis 2.228 4.8e-04
medulloblastoma, large-cell 1.200 2.3e-04
primitive neuroectodermal tumor 1.100 1.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.332 2.3e-03
juvenile dermatomyositis 1.254 1.1e-11
acute quadriplegic myopathy 1.731 3.6e-07
lung cancer -1.400 9.9e-03
colon cancer -2.700 3.9e-03
active ulcerative colitis -1.158 1.5e-02
pancreatic carcinoma -1.200 5.8e-03
nasopharyngeal carcinoma -1.300 9.9e-03
mucosa-associated lymphoid tissue lympho... 1.718 2.0e-02
ovarian cancer -2.800 1.2e-08
chronic rhinosinusitis -1.117 8.5e-03

Gene RIF (39)

PMID Text
26621336 Low expression of Mtss1 is associated with Chronic myeloid leukemia.
26316204 MTSS1 plays an essential inhibitory role in the development and progression of ovarian cancers
26198729 Down-regulation of MTSS1 expression is associated with lymph node metastasis in Pancreatic Cancer.
26119942 human breast tumors data sets the MTSS1/p63 co-expression is a negative prognostic factor on patient survival, suggesting that the MTSS1/p63 axis might be functionally important to regulate breast tumor progression
25996952 our findings suggest that MTSS1 might have a context-dependent function and could act as a tumor suppressor, which is pharmacologically targetable in AML patients.
25783158 EGF induces microRNAs that target suppressors of cell migration: miR-15b targets MTSS1 in breast cancer.
25625275 Data shows that MTSS1 is highly expressed in non-small-cell lung carcinomas compared with non-neoplastic lung tissues and may serve as an independent prognostic factor.
25385572 These results implicate that the role of MTSS1 suppresses cell migration and invasion by inhibiting expression of CTTN and as a prognosis biomarker in Glioblastomas
25287652 The absence of MIM led to PTPdelta-mediated activation of SRC.
24632752 MTSS1 is a metastasis driver in a subset of human melanomas.
24318128 Study provides a novel molecular mechanism for the negative regulation of MTSS1 by beta-TRCP in cancer cells.
23852458 MTSS1 expression was analyzed in normal and cancerous tissue specimens from Chinese patients with Hilar cholangiocarcinoma.
23474751 In breast tumor samples, miR-182 induction is linked to downregulation of MIM, RhoA activation and poor prognosis.
23383207 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
23350348 Loww MTSS1 expression is associated with kidney cancer.
23017832 Data show that the expression of the metastasis suppressor 1 (MTSS1) gene was regulated by miR-135a overexpression and knockdown.
22721729 the dimeric configuration is essential for MIM-mediated membrane remodelling and serves as a proper target to develop antagonists specifically against an I-BAR-domain-containing protein.
22681717 Compared with normal tissue, miR-182 was up-reg'd and MTSS1 was down-reg'd in HCC tissues. Over-expression of miR-182 was correlated with intrahepatic metastasis. There was a negative correlation between miR-182 and MTSS1 expression in both HCC tissues.
22479308 Data show that Mtss1 drives enhanced junction formation specifically by elevating Rac-GTP.
22455847 MiR-23a expression promotes colon carcinoma cell growth, invasion and metastasis through inhibition of the MTSS1 gene.
22100162 Anthrax edema toxin induced transendothelial cell tunnels are resealed by MIM via Arp2/3-driven actin polymerization.
21965727 MTSS1 is expressed at low levels or is absent from human bladder cancer cells.
21927027 at high cell densities, Mtss1 impacts negatively on EGF signaling and this suggests why it inhibits metastasis.
21909138 MTSS1 was characterized as a novel tumor suppressor gene in hepatocellular carcinoma
21696600 MTSS1 serves as a potential prognostic indicator in human oesophageal squamous cell carcinoma and may be an important target for cancer therapy.
21196400 the current knowledge of MTSS1's role in cancer metastasis, carcinogenesis, and development is discussed.
20712855 Downregulation of metastasis suppressor 1 is associated with nodal metastasis and gastric cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19328678 MTSS1 is a prognostic indicator of disease-free survival in breast cancer patients and demonstrates the ability to play a role in governing the metastatic nature of breast cancer cells.
17442377 Elevated MIM-B expression may influence the development of hepatocellular carcinoma and may possibly be a powerful indicator for the disease at an early stage.
16921485 The expression of metastasis suppressor MIM is regulated by DNA methylation of a CpG island within its promoter region.
16280553 MIM-B is unlikely to be a metastasis suppressor but acts as a scaffold protein that interacts with Rac, actin and actin-associated proteins to modulate lamellipodia formation.
15684034 MTSS1, also known as MIM, is a modular hedgehog inducible protein that contains a dimerization domain and a distinct activation/scaffolding domain that binds RPTPdelta and induces membrane projections.
15545630 MTSS1, also known as MIM, is a hedgehog inducible protein expressed in carcinomas that potentiates Gli transcription factor activity
15488640 Our data indicate that down-regulation of MIM and/or MIM-B expression can occur in bladder cancer cell lines but is not associated with increased invasive behaviour.
14752106 missing in metastasis protein and insulin receptor tyrosine kinase substrate p53 have a conserved novel actin bundling/filopodium-forming domain
12082544 a potential metastasis suppressor gene in bladder cancer; data suggest that it may be involved in cytoskeletal organization

AA Sequence

MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQKVADMATNTRG      1 - 70
GTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVANQLDKDHAKEYKKARQEIKKK     71 - 140
SSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETEKQAVRKALIEERGRFCTFISMLRPVIEEEI    141 - 210
SMLGEITHLQTISEDLKSLTMDPHKLPSSSEQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSV    211 - 280
NSSDSRSSGSHSHSPSSHYRYRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGF    281 - 350
SHYSLSSESHVGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQ    351 - 420
PLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELALALSRGLQLD    421 - 490
TQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQEFDKSSTIPRNSDISQSYRR    491 - 560
MFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVRRGTIGAGPIPIKTPVIPVKTPTVPDLPGVL    561 - 630
PAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQER    631 - 700
EPPSATVSPGQIPESDPADLSPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS                   701 - 755
//

Text Mined References (54)

PMID Year Title
26621336 2016 Mtss1 is a critical epigenetically regulated tumor suppressor in CML.
26316204 2015 Metastasis suppressor 1 expression in human ovarian cancer: The impact on cellular migration and metastasis.
26198729 2016 Expression and Significances of MTSS1 in Pancreatic Cancer.
26119942 2016 p63 controls cell migration and invasion by transcriptional regulation of MTSS1.
25996952 2015 Identification of the Adapter Molecule MTSS1 as a Potential Oncogene-Specific Tumor Suppressor in Acute Myeloid Leukemia.
25783158 2015 EGF induces microRNAs that target suppressors of cell migration: miR-15b targets MTSS1 in breast cancer.
25625275 2015 Downregulation of MTSS1 expression is an independent prognosticator in squamous cell carcinoma of the lung.
25385572 2015 MTSS1 suppresses cell migration and invasion by targeting CTTN in glioblastoma.
25287652 2015 Missing-in-Metastasis regulates cell motility and invasion via PTP?-mediated changes in SRC activity.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24632752 2014 MTSS1 is a metastasis driver in a subset of human melanomas.
24318128 2013 SCF ?-TRCP targets MTSS1 for ubiquitination-mediated destruction to regulate cancer cell proliferation and migration.
23852458 2013 Loss of MTSS1 expression is an independent prognostic factor for Hilar cholangiocarcinoma.
23474751 2014 Suppression of MIM by microRNA-182 activates RhoA and promotes breast cancer metastasis.
23383207 2013 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23350348 2012 The tumour suppressive role of metastasis suppressor-1, MTSS1, in human kidney cancer, a possible connection with the SHH pathway.
23017832 2012 MiR-135a promotes growth and invasion of colorectal cancer via metastasis suppressor 1 in vitro.
22721729 2012 Dimerization is necessary for MIM-mediated membrane deformation and endocytosis.
22681717 2012 MicroRNA-182 downregulates metastasis suppressor 1 and contributes to metastasis of hepatocellular carcinoma.
22479308 2012 Mtss1 promotes cell-cell junction assembly and stability through the small GTPase Rac1.
22455847 2012 [Expression and clinical significance of miR-23a and metastasis suppressor 1 in colon carcinoma].
22100162 2011 cAMP signaling by anthrax edema toxin induces transendothelial cell tunnels, which are resealed by MIM via Arp2/3-driven actin polymerization.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21965727 2011 Metastasis suppressor-1, MTSS1, acts as a putative tumour suppressor in human bladder cancer.
21927027 2012 Mtss1 regulates epidermal growth factor signaling in head and neck squamous carcinoma cells.
21909138 2012 MTSS1, a novel target of DNA methyltransferase 3B, functions as a tumor suppressor in hepatocellular carcinoma.
21696600 2011 The impact of Metastasis Suppressor-1, MTSS1, on oesophageal squamous cell carcinoma and its clinical significance.
21196400 2011 MTSS1: a multifunctional protein and its role in cancer invasion and metastasis.
20712855 2010 Downregulation of metastasis suppressor 1(MTSS1) is associated with nodal metastasis and poor outcome in Chinese patients with gastric cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
19328678 2009 Metastasis suppressor 1 (MTSS1) demonstrates prognostic value and anti-metastatic properties in breast cancer.
18088087 2008 Phosphoproteome of resting human platelets.
17442377 2007 Clinicopathological significance of missing in metastasis B expression in hepatocellular carcinoma.
16921485 2006 The expression of metastasis suppressor MIM/MTSS1 is regulated by DNA methylation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16280553 2005 Involvement of Rac in actin cytoskeleton rearrangements induced by MIM-B.
15688017 2005 Differential regulation of cortactin and N-WASP-mediated actin polymerization by missing in metastasis (MIM) protein.
15684034 2005 Receptor tyrosine phosphatase-dependent cytoskeletal remodeling by the hedgehog-responsive gene MIM/BEG4.
15545630 2004 MIM/BEG4, a Sonic hedgehog-responsive gene that potentiates Gli-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488640 2004 Expression and regulation of MIM (Missing In Metastasis), a novel putative metastasis suppressor gene, and MIM-B, in bladder cancer cell lines.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
14752106 2004 A novel actin bundling/filopodium-forming domain conserved in insulin receptor tyrosine kinase substrate p53 and missing in metastasis protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12570871 2003 MIM-B, a putative metastasis suppressor protein, binds to actin and to protein tyrosine phosphatase delta.
12482861 2003 Mouse MIM, a tissue-specific regulator of cytoskeletal dynamics, interacts with ATP-actin monomers through its C-terminal WH2 domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082544 MIM, a potential metastasis suppressor gene in bladder cancer.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.