Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.97
PubTator Score 103.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.700 5.2e-03
osteosarcoma -1.824 2.5e-05
ovarian cancer -1.200 5.1e-08
psoriasis -1.600 7.6e-04

Gene RIF (2)

AA Sequence

MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLW      1 - 70
KHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKSL     71 - 140
NKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDM    141 - 210
YQNYSCYKHWQFELLNYTPADYGGLHHAAARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTM    211 - 280
SVIVLPQPDEVDVKLDPKDLRIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFR    281 - 350
VLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQL    351 - 420
IQRLLQSADEEAIAELLDEHLKSAK                                                 421 - 445
//

Text Mined References (10)

PMID Year Title