Property Summary

NCBI Gene PubMed Count 359
PubMed Score 289.98
PubTator Score 153.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 2.3e-06
osteosarcoma -1.149 2.8e-03
acute quadriplegic myopathy 1.376 1.2e-05
group 4 medulloblastoma -1.300 5.1e-03
progressive supranuclear palsy -1.500 7.4e-03
ovarian cancer 1.500 4.1e-03

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (391)

PMID Text
26833750 MTR A2756G single nucleotide polymorphism is significantly associated with gastric cancer risk in Korea.
26595280 According to our results, the MTR A2756G polymorphism was associated with the risk of retinoblastoma in Iranian patients.
26337056 Low folate status and homocysteine metabolism gene polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) may have a synergistic effect towards increasing the incidence of dyslipidemia in Chinese hypertensive population.
26334892 Methionine synthase (MTR) and methionine synthase reductase (MTRR) polymorphisms were significantly associated with the increased neural tube defects risk in a Chinese population.
26299783 Data suggest impaired folate metabolism down-regulates placenta trophoblast proliferation, viability, invasive capacity, and progesterone secretion; silencing MTR gene down-regulates cell proliferation and up-regulates progesterone secretion.
26266420 interactions among homocysteine metabolism gene polymorphisms in MTHFR, MTR and MTRR lead to dramatic elevations in the folate deficiency risk
26196053 no association of rs1805087 with non-obstructive azoospermia
26154858 polymorphisms of the MTHFR, MTRR, and MTR enzymes are well documented as folate deficiency-related disorders. The aim of this study was to compare the genotypic distribution of these gene polymorphisms between patients with acromegaly and controls.
26090795 Variation in MTHFR, MTR, and MTRR were significantly associated with percent LINE-1 methylation.DNA methylation of LINE-1 elements in histologically normal breast tissues is influenced by polymorphisms in genes in the one-carbon metabolism pathway
26063524 MTR genetic polymorphisms are risk factor for predicting cardiovascular manifestations in Marfan syndrome.
25919635 There was a significant positive correlation between serum concentrations of vitamin B12 and regional GM (grey matter ) volume in APOE epsilon4 carriers with AD but not in non-carriers.
25822709 In summary, hyperhomocysteinemia was related with increased risk of decline in executive functioning, complex attention, cognitive flexibility, and memory in postmenopausal women.
25801727 An increase of placental mRNA levels in the pre-eclampsia group was observed for MTR and cystathionine gamma-lyase.
25754229 association between gene polymorphisms of folate cycle (MTHFR 677 C>T, MTHFR 1298 A>C, MTR 2756 A>G, and MTRR 66 A>G) and the risk of pulmonary embolism (PE)
25730024 We found that the compound mutation genotypes MTHFD-G1958A, MTR-A2756G, and RFC1-G80A increased the risk of preterm birth (OR = 2.88, 95%CI = 1.08-7.72, P = 0.028).
25578539 We found no evidence for an association between any of these variants (MTHFR C677T and A1298C, MTR A2756G and MTRR A66G) and male infertility
25531253 Results show that an association of the G-allele of the methionine synthase variant c.2756A>G (D919G) with global DNA methylation.
25366783 Data show no significant effect of the 5,10-methylenetetrahydrofolate reductase (MTHFR) A1298C and methionine synthase (MTR) A2756G on the risk of breast cancer, but that MTHFR C667T polymorphism is associated with the risk of breast cancer.
25293959 Genetic association replicative and exploratory studies identify SNPs in ADA and MTR highly associated with isolated Neural tube defects (NTD)and SNP in ARID1A and ALDH1A2 associated with NTDs in whites and African Americans respectively.
25277375 results suggest that methionine synthase in the villous trophoblast participates in the metabolism of homocysteine by using folate
25217320 This case-control study found that the MTHFR C677T and MTR A2756G polymorphisms are associated with risk of breast cancer, and folate, vitamin B6, and vitamin B12 intakes influence these associations.
25077679 5-methyltetrahydrofolate-homocysteine methyltransferase gene polymorphism does not have modification effects on the risk of CRC.
25052622 Our findings suggest a causal role for maternal homocysteine (1-C metabolism) in fetal growth
24956146 Studies do not indicate a major role of the 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR) rs1805087 A> G polymorphism in modulating non-Hodgkin lymphoma (NHL) risk.
24595101 This meta-analysis demonstrated a suggestive result that the A66G variant in MTRR, but not the A2756G in MTR, may be associated with the increase of congenital heart disease risks.
24166605 There was a significant association of breast cancer risk with MTR 2756 GG and AA polymorphism.
24150725 Present data do not support a role for MTR 2756A>G as independent maternal risk factor for a Down syndrome birth.
24103477 data provide evidence that the MTR A2756G polymorphism increases the level of DNA methylation and confirm the previous reports that the MTHFR C677T polymorphism is associated with DNA hypomethylation
24087922 found limited evidence that the maternal MTR rs1804742 appeared to interact with higher folic acid levels to influence childhood acute lymphoblastic leukemia risk
24051177 Our results show that elevated homocysteine plasma level may characterize schizophrenia patients' male siblings.
23986219 A review of the influences of genetic polymorphisms in methionine synthase on the occurrence of adverse effects from methotrexate therapy.
23954866 MTR 2756 AA genotypes were associated with higher Hcy concentrations (16.6 and 10.1 mumol/L; p<0.05) compared to subjects harboring the MTHFR 677 CT/CC and the MTR 2756 AG genotypes (10.5, 9.7 and 9.5 mumol/L, respectively).
23906019 our study provides evidence suggesting that MTR A2756G is associated with a reduced risk of developing childhood ALL.
23864153 No association between MS A2756G polymorphism and cervical cancer was detected in the worldwide population.
23845785 findings suggest that MTR A2756G polymorphism is not associated with altered susceptibility to breast cancer, while the observed decreased risk in Caucasians
23825108 data suggest that the interaction of methionine synthase with MMACHC may play a role in the regulation of the cellular processing of cobalamins that is required for cobalamin cofactor synthesis
23818366 MTR SNPs do not appear to play a major role in lymphoma susceptibility in a Spanish population.
23798577 Results show that regulatory variants of the MTR gene increase CHD risk by reducing MTR expression and inducing the homocysteine accumulation and elevation.
23613867 This meta-analysis suggests that there is no significant association between the MTR A2756G polymorphism and digestive system cancer risk.
23595572 Trend analyses also revealed the marginally significant lower risk of chronic kidney disease with increasing number of MTR A2756G G allele.
23593229 MTR A2756G polymorphism is not associated with CRC/CRA susceptibility and that gene-environment interaction may exist.
23489792 Genetic interaction between MTHFR and MS genes raises the probability of neural tube defects.
23459165 The MTHFR C677T polymorphism has significant effects on susceptibility to prostate cancer in Ecuadorian population, especially with the Gleason grade; on the other hand, a significant association between MTHFR A1298C, MTRR A66G, and MTR A2756G with the pathological characteristics was not found (P > 0.05).
23438943 no associations between the MTR A2756G polymorphism and neural tube defects risk were found in meta-analysis of genetic models
23430981 Haplotype analysis of migraine risk indicates one haplotype block in MTHFR, one block in methionine synthase reductase (MTR), and two blocks in methionine synthase reductase (MTRR).
23425389 [meta-analysis] MTR A2756G polymorphisms are not associated with risks for neural tube defects in Caucasian children.
23415967 Methionine synthase 2756AA genotype and 2756A-TS 6-bp allele combination are predisposing factors for recurrent pregnancy loss in a sample of South Korean women.
23266814 meta-analysis indicated that MTRR A66G polymorphism, but not MTR A2756G, is significantly associated with maternal risk for neural tube defects in Caucasians
23155246 this study points out the importance of the interactions between the MTHFR C677T, MTHFR A1298C and MTR A2756G polymorphisms in breast cancer
22855024 These findings indicate that locus A2756G in the MTR gene may play a role in susceptibility to congenital anomalies of the cardiovascular system in West Siberia.
22803112 No statistically significant association with prostate cancer was detected for the polymorphic locus A2756G of methionine synthase gene.
22719222 No significant association was found between MTR A2756G polymorphisms and the risk of CRC.
22470444 The average changes in plasma homocysteine levels for methionine synthase 2756AG and GG variants were negative [beta(SE beta), -0.56(0.58) and -0.83(0.99) micromol/L, respectively].
22453148 Polymorphisms of MTHFR and MTR genes are not related to susceptibility to childhood ALL in North India
22407825 an increase in the risk of colorectal adenomas associated with methionine synthase 2756GG genotype
22339686 We found weak evidence of a recessive effect of the G allele in MTR A2756G (odds ratio, 1.61 [95% confidence interval, 0.98-2.66]; p=0.06)and risk for coronaryh artery diseae.
22236648 the single-nucleotide polymorphism A2756G MTR is not involved in the development of breast cancer.
22005284 Constituents of the folate cycle could be involved in the etiology of idiopathic intellectual disability.
21956592 no significant association was found between TYMS or the MTR polymorphisms and the risk of primary liver cancer
21947961 The MTR 2756G allele, extent of the disease, and gender were the independent determinants of hyperhomocysteinemia in these patients.
21780915 MTR A2756G polymorphism, but not MTRR A66G and MTHFR A1298C, is associated with risk of coronary heart disease for Europeans.
21775772 MTHFR C677T and MTR A2756G polymorphisms could be an important genetic factor predisposing to idiopathic infertility in Brazilian men.
21774403 The heterozygous MTR 2756AG genotype was associated with 1.5-fold increased risk of CL/P compared with the AA genotype (OR = 1.48).
21737517 MTR gene polymorphisms are associated with with the development, but not progression, of IgA nephropathy.
21643952 The methionine synthase A2756G polymorphism is not a risk factor for susceptibility to acute lymphoblastic leukemia amongst Kurdish children in Western Iran.
21605004 There were no significant associations of the polymorphisms of TYMS 3R-->2R or MTR 2756 A-->G with the risk of NSCLC
21603981 These data suggest that all polymorphisms coding for MTHFR, MTR, MTRR and TS have consistent roles in the increased risk of sporadic colorectal adenocarcinoma among the southeastern population of Brazil.
21567207 All the three gene polymorphisms, namely, MTHFR, MTR and ACE showed significant association with the vascular disease
21385350 The present study has found that the MTHFR 677T allele has a favorable effect on a risk of hearing impairment in the middle-aged and elderly population, only when the individuals were wild-type homozygotes for MTR A2756G.
21349258 The genotype and allele frequencies of the MTR Asp919Gly, MTHFR Ala222Val, MTHFD1 Arg653Gln and MTRR Ile22Met gene variants did not display statistical differences between patients with cervical cancer and controls.
21092627 There was no significant association between coronary artery disease and MTR A2756G polymorphism.
21070756 the synergistic effects of polymorphisms in the folate metabolic pathway genes in Parkinson's disease susceptibility
21070756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21055808 Data show that a marginally statistically significant association of MTR 2756G with a reduced risk of NHL.
21055808 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
21045271 the methionine synthase A2756G SNP A/G or G/G genotype and the methylenetetrahydrofolate reductase C677T SNP T/T genotype were considered double genetic risk factors for elevated homocysteine levels
21045269 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20960050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20955826 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20890936 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20883119 Observational study of gene-disease association. (HuGE Navigator)
20852008 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20737570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20723587 Observational study of gene-disease association. (HuGE Navigator)
20670920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615890 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20549016 Germ line polymorphisms in the folate- and methyl-associated genes MTHFR, MTR and MTRR, were analyzed in colorectal cancer patient cohort to find a possible link between these genetic variants and p16 hypermethylation.
20549016 Observational study of gene-disease association. (HuGE Navigator)
20544798 Observational study of gene-disease association. (HuGE Navigator)
20532609 Environmental factors played a more important role in urothelial carcinoma carcinogenesis than MTHFR or methionine synthase (MS) gene polymorphism.
20532609 Observational study of gene-disease association. (HuGE Navigator)
20490431 data provide evidence that supports an association between MTR polymorphism and the risk of head and neck squamous cell cancer
20490431 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20466634 Data show that MTHFR 677C>T and MTRR 66A>G polymorphisms are two independent risk factors for DS pregnancies in young women, but RFC-1 80G>A and MTR 2756A>G polymorphism are not independent risk factor.
20466634 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20447924 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20445573 Our results suggest that the effects of methylenetetrahydrofolate reductase C677T and methionine synthase A2756G gene polymorphisms may have pivotal roles in the aetiology of essential hypertension and blood pressure response to benazepril.
20445573 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
20310006 This study presents evidence for an association between the MTR A2756G polymorphism and retinoblastoma susceptibility in a Northeast population from Brazil
20310006 Observational study of gene-disease association. (HuGE Navigator)
20237949 Observational study of gene-disease association. (HuGE Navigator)
20235210 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20209990 Observational study of gene-disease association. (HuGE Navigator)
20180013 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20111902 the MTR A2756G polymorphism may contribute to susceptibility to breast cancer among Europeans.
20111902 Meta-analysis of gene-disease association. (HuGE Navigator)
20101025 Genetic variation in the methionine synthase is associated with childhood leukemia.
20101025 Observational study of gene-disease association. (HuGE Navigator)
20085490 Meta-analysis of gene-disease association. (HuGE Navigator)
20082058 Observational study of gene-disease association. (HuGE Navigator)
20056620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031554 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19843671 MTR polymorphisms are associated with colorectal cancer.
19843671 Observational study of gene-disease association. (HuGE Navigator)
19838916 A case-control study in Japan failed to find significant associations between polymorphisms of MTR or MTHFR (5,10-ethylenetetrahydrofolate reductase) genes and breast cancer risk.
19838916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19837268 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19826453 MTR A2756G polymorphism is a candidate gene polymorphism for cancer susceptibility regardless of environmental factors.
19826453 Meta-analysis of gene-disease association. (HuGE Navigator)
19777601 Observational study of gene-disease association. (HuGE Navigator)
19776634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19776626 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19760026 there was no significant association between most SNPs in methionine synthase , and the risk of cervical intraepithelial neoplasia and cervical cancer in Korean women.
19760026 Observational study of gene-disease association. (HuGE Navigator)
19751277 No asssociation between MTR single nucleotide polymorphism 2756A > G and both, follicular lymphoma and diffuse, large B-Cell lymphoma was observed in a cohort of swedish patients.
19737740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19729796 Maternal folate-related polymorphisms studied here (CBS, MTR, RFC-1, and TC) have no influence on trisomy 21 susceptibility in subjects of Brazilian population.
19729796 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19706844 Meta-analysis of gene-disease association. (HuGE Navigator)
19706843 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19683694 Observational study of gene-disease association. (HuGE Navigator)
19649727 The polymorphism distribution of genes encoding MTR, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and MTHFD1 and MTHFR in patients with larynx cancer, was examined.
19649727 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19619240 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19588544 The strongest result obtained by this study was for an additive effect between smoking status, slow NAT2 variants, MTR 2756*G and MTHFR 677*T alleles, in affecting bladder cancer risk
19588544 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19533788 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19504454 Observational study of gene-disease association. (HuGE Navigator)
19493349 Observational study of gene-disease association. (HuGE Navigator)
19427504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19394322 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19389261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19353223 Observational study of gene-disease association. (HuGE Navigator)
19349296 MTHFR 677C>T/1298A>G and MTR 2756A>G polymorphism distribution in both recipients (R) and donors (D) showed no significant difference between matches with loss of graft function and those with long-term graft survival
19349296 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19332728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
19283448 A2756G genotype not associated with plasma homocysteine, folate, or methylmalonic acid
19283448 Observational study of gene-disease association. (HuGE Navigator)
19263808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240236 Overall, we found no evidence that common polymorphisms of the MTHFR and MTR genes are associated with promoter methylation of E-cadherin, p16, and RAR-beta2 genes in breast cancer.
19240236 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19159907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19124508 The MTR A2756G interacted with alcohol and folate intake to influence the risk of colorectal adenoma.
19124508 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19112534 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19074750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19064578 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19034339 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19020309 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19019492 Observational study of gene-disease association. (HuGE Navigator)
18996879 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18988749 Observational study of genetic testing. (HuGE Navigator)
18983896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18844488 significant but not independent association between the 2756A>G polymorphism of the MTR (presence of G allele) and MI in the Tunisian population
18844488 Observational study of gene-disease association. (HuGE Navigator)
18843018 Risk of pancreatic cancer was increased with alcohol consumption in subjects with the MTR 2756 AA genotype.
18843018 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18842997 The presence of MTR A2756G mutant allele and MTHFR C677T mutant allele in BRCA carriers was associated with increased breast cancer risk.
18842997 Observational study of gene-disease association. (HuGE Navigator)
18842806 Observational study of gene-disease association. (HuGE Navigator)
18836720 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18815869 combined genotypes of MTHFR and methionine synthase polymorphisms were associated with significantly increased risk of bladder cancer.
18815869 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
18801628 Data did not show differences in the distribution of MTR 2756A>G and MTHFD1 1958G>A polymorphic variants postmenopausal women with and without depression. The MTR GG genotype exhibited a 5.750-fold increased risk of depression in postmenopausal women.
18801628 Observational study of gene-disease association. (HuGE Navigator)
18799873 Observational study of gene-disease association. (HuGE Navigator)
18785313 Observational study of gene-disease association. (HuGE Navigator)
18771981 This study suggests the maternal and fetal MTR2756G allele is an important risk factor in the development of uteroplacental insufficiency.
18771981 Observational study of gene-disease association. (HuGE Navigator)
18700049 Methionine synthase is associated with risk and extent of ulcerative colitis, at least in Central China
18700049 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18620331 Observational study of gene-disease association. (HuGE Navigator)
18607581 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18498768 Observational study of gene-disease association. (HuGE Navigator)
18485163 Observational study of gene-disease association. (HuGE Navigator)
18483342 The MTR A2756G genotype showed a non-significant association between homozygosity and decreased risk of glioblastoma.
18483342 Observational study of gene-disease association. (HuGE Navigator)
18447718 The results of this study suggest that genetic variants of methionine metabolism are associated with meningioma formation.
18447718 Observational study of gene-disease association. (HuGE Navigator)
18435414 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)
18406541 Observational study of gene-disease association. (HuGE Navigator)
18386810 Observational study of gene-disease association. (HuGE Navigator)
18378576 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18351371 Methylenetetrahydrofolate reductase and Methionine synthase polymorphisms might have protective effect on the risk of cervical cancer in the North Indian women.
18351371 Observational study of gene-disease association. (HuGE Navigator)
18329006 Our data did not reveal significant association between the methionine synthase polymorphism and Alzheimer disease development
18322994 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18281142 The SNP 2756 A>G in the methionine synthase gene does not appear to influence the plasma Hcy levels.
18281142 Observational study of gene-disease association. (HuGE Navigator)
18273817 The presence of the genetic polymorphism of MTR is a maternal risk factor for Down syndrome in Brazil.
18273817 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18249021 Observational study of gene-disease association. (HuGE Navigator)
18222012 A 2756 A - G polymorhpism in the MTR gene seems to be associated with homocysteine.
18204969 Observational study of gene-disease association. (HuGE Navigator)
18199722 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18174236 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18060320 Hcy concentrations were significantly increased in the MTR 2756AG heterozygous genotype compared to the MTR 2756AA wild-type genotype.
18060320 Observational study of gene-disease association. (HuGE Navigator)
18053808 Observational study of gene-disease association. (HuGE Navigator)
18034637 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18023275 Observational study of gene-disease association. (HuGE Navigator)
18004208 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17993766 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17993766 These findings suggest that in obese subjects, homocysteine cycle efficiency is impaired by MTHFR, MTR, and MTRR inability to supply methyl-group donors, providing evidence that MTHFR, MTR, and MTRR gene polymorphisms are genetic risk factors for obesity.
17967524 Homozygosis for the MTR 2756CC genotype was not related to prostatic carginogenesis
17967524 Observational study of gene-disease association. (HuGE Navigator)
17925002 Observational study of gene-disease association. (HuGE Navigator)
17904392 Observational study of gene-disease association. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17853476 Observational study of gene-disease association. (HuGE Navigator)
17853476 The risk of having a child with congenital malformation or FACS was three to four times higher for mothers who were MTHFR 677TT homozygotes compared with MTHFR 677CC homozygotes
17822659 Observational study of gene-disease association. (HuGE Navigator)
17726616 no association between methionine synthase A2756G polymorphism insertion polymorphism and cancer of the upper gastrointestinal tract.
17726616 Observational study of gene-disease association. (HuGE Navigator)
17702010 Observational study of gene-disease association. (HuGE Navigator)
17691219 Observational study of gene-disease association. (HuGE Navigator)
17691219 The results indicate that of the enzymes studied the polymorphisms of MTR no significant differences in intensity of turnover of circulating thiols between AD and PD patients.
17664238 study found that MTR 2756AG (919DG) or GG (919GG) genotype exhibited 2.005-fold increased risk of systemic lupus erythematosus (95% CI = 1.177-3.416, P = 0.0146)
17655928 These results suggest, for the first time, a role for the MTR A2756G polymorphism in MM risk in our country.
17655928 Observational study of gene-disease association. (HuGE Navigator)
17636160 Observational study of gene-disease association. (HuGE Navigator)
17617021 Observational study of gene-disease association. (HuGE Navigator)
17611986 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17596206 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17595805 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17590289 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17581676 Observational study of gene-disease association. (HuGE Navigator)
17581676 Results suggest that the alterations of folate metabolism related to MTHFR, MTR and MTRR polymorphisms are not involved in clefting in South Brazil.
17574963 Observational study of gene-disease association. (HuGE Navigator)
17553479 Observational study of gene-disease association. (HuGE Navigator)
17551576 study of whether C677T & A1298C MTHFR, A2756G MTR & -786 C/T eNOS polymorphisms are associated with NonValvular Atrial Fibrillation; data show the polymorphisms were not associated with an increased risk of NVAF per se or in combination
17551576 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17546637 Observational study of gene-disease association. (HuGE Navigator)
17533396 Observational study of gene-disease association. (HuGE Navigator)
17522601 Serum folate and MTHFR C677T and MTR A2576G gene polymorphisms were the determinants for tHcy levels.
17522601 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17461517 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17454638 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17450230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17449906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17436311 Observational study of gene-disease association. (HuGE Navigator)
17417062 Observational study of gene-disease association. (HuGE Navigator)
17412799 Observational study of gene-disease association. (HuGE Navigator)
17339646 Observational study of gene-disease association. (HuGE Navigator)
17339646 MTR genotype is not associated with cognitive functioning, cognitive decline, or survival among nonagenarians
17311260 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17311259 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17287836 a significant association of the MTR polymorphism c.2756A>G (D919G) with diastolic blood pressure was found which might explain the beneficial effects of its G-allele on vascular disease and disease-free longevity
17220339 Observational study of gene-disease association. (HuGE Navigator)
17160942 Observational study of gene-disease association. (HuGE Navigator)
17152488 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17151928 Observational study of gene-disease association. (HuGE Navigator)
17119116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17119065 Observational study of gene-disease association. (HuGE Navigator)
17119065 the methionine synthase polymorphism c.2756A>G alters susceptibility to glioblastoma multiforme
17074544 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17035141 Observational study of gene-disease association. (HuGE Navigator)
17024475 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17009228 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985020 Clinical trial of gene-disease association. (HuGE Navigator)
16947783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16894458 Observational study of gene-disease association. (HuGE Navigator)
16861746 Observational study of gene-disease association. (HuGE Navigator)
16799656 Observational study of gene-disease association. (HuGE Navigator)
16778415 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16712703 Observational study of gene-disease association. (HuGE Navigator)
16712703 Mothers with c.2756AG or GG genotype displayed a 2.195-fold increased risk of having a child with non-syndromic cleft lip with or without cleft palate.
16709328 Observational study of gene-disease association. (HuGE Navigator)
16580699 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16485733 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16470748 Observational study of gene-disease association. (HuGE Navigator)
16407418 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16365025 Observational study of gene-disease association. (HuGE Navigator)
16333305 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16328059 Observational study of gene-disease association. (HuGE Navigator)
16284371 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16268464 Observational study of gene-disease association. (HuGE Navigator)
16142417 Observational study of gene-disease association. (HuGE Navigator)
16142417 The methionine synthase G-allele was significantly higher in the older than in the younger individuals and the influence of the genotype on male subjects became relevant at a younger age as opposed to female subjects suggesting a gender-dependent effect.
16115349 Observational study of gene-disease association. (HuGE Navigator)
16051637 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16051610 analysis of the B12-responsive internal ribosome entry site (IRES) element in human methionine synthase
16013960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16006998 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15979034 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15894670 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15894670 Finds that MTR variant AG and AG/GG genotypes associated with a significantly increased squamous cell head and neck cancer risk.
15889417 Observational study of gene-disease association. (HuGE Navigator)
15866085 Observational study of gene-disease association. (HuGE Navigator)
15820491 Observational study of gene-disease association. (HuGE Navigator)
15820491 The effect of C677T methylenetetrahydrofolate reductase and A2756G methionine synthase polymorphisms could affect the relative risk for MI is reported.
15797993 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15790587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15719048 Observational study of gene-disease association. (HuGE Navigator)
15612980 Observational study of gene-disease association. (HuGE Navigator)
15598777 Observational study of gene-disease association. (HuGE Navigator)
15551285 Observational study of gene-disease association. (HuGE Navigator)
15514969 Observational study of gene-environment interaction. (HuGE Navigator)
15354395 Observational study of gene-disease association. (HuGE Navigator)
15205694 Observational study of gene-disease association. (HuGE Navigator)
15202865 Methionine synthase gene variation in parents is associated with occurrence of congenital heart defects in offspring
15201366 Observational study of gene-disease association. (HuGE Navigator)
15198953 Observational study of gene-disease association. (HuGE Navigator)
15159311 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15148588 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15148588 D919G polymorphism of methionine synthase gene has a role in blood pressure response to antihypertensive agents
15138479 Observational study of gene-disease association. (HuGE Navigator)
15117811 Polymorphisms of methionine Synthase is associated wtih bladder cancer
15111988 Observational study of genotype prevalence. (HuGE Navigator)
15098482 Observational study of gene-disease association. (HuGE Navigator)
15044114 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14977639 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
14744749 Observational study of gene-disease association. (HuGE Navigator)
12964809 Observational study of genotype prevalence. (HuGE Navigator)
12923861 Observational study of gene-disease association. (HuGE Navigator)
12923861 polymorphisms in methionine synthase is associated with increased risk for Down syndrome
12893022 Observational study of gene-disease association. (HuGE Navigator)
12893022 Despite absence of association with plasma homocysteine, the GG genotype represented a four-fold increased risk of coronary disease when compared to AA genotype.
12876480 Observational study of gene-disease association. (HuGE Navigator)
12855226 Observational study of gene-disease association. (HuGE Navigator)
12810988 Results of screening mutations 2756A-->G and 66A-->G in MTR and MTRR genes respectively show that are might have an effect on NTDs incidence (neural tube defects).
12716294 Observational study of gene-disease association. (HuGE Navigator)
12670934 B12 supplementation does not alter mRNA or protein turnover rates but induces translational up-regulation of MTR by shifting the mRNA from the ribonucleoprotein to the polysome pool.
12649067 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12649067 results indicate that MTRR and MTR genes may interact to increase the infants' Neural tube defects risks
12648076 Observational study of gene-disease association. (HuGE Navigator)
12642343 Observational study of gene-disease association. (HuGE Navigator)
12482550 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12375236 Variants influence the risk of spina bifida via the maternal rather than the embryonic genotype.
12372672 Observational study of gene-disease association. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12154064 Observational study of gene-disease association. (HuGE Navigator)
12111380 Observational study of gene-disease association. (HuGE Navigator)
12111380 polymorphisms in methionine synthase is associated with increased risk for neural tube defects
12091127 Observational study of gene-disease association. (HuGE Navigator)
12068375 Hyperhomocysteinemia due to methionine synthase deficiency, cblG: structure of the MTR gene, genotype diversity, and recognition of a common mutation, P1173L.
12020105 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12015064 Observational study of gene-disease association. (HuGE Navigator)
11920232 polymorphisms are not risk factors for venous thromboembolism [methionine synthase and methylenetrahydrofolate reductase]
11684547 Observational study of gene-gene interaction. (HuGE Navigator)
11672761 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
11592436 Observational study of gene-disease association. (HuGE Navigator)
11584084 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11342450 Observational study of gene-disease association. (HuGE Navigator)
11257268 Observational study of gene-disease association. (HuGE Navigator)
11204591 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11186937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11074524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11074217 Observational study of gene-disease association. (HuGE Navigator)
10791559 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-environment interaction, and healthcare-related. (HuGE Navigator)

AA Sequence

MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDIL      1 - 70
SITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKR     71 - 140
FVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQ    141 - 210
NLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTA    211 - 280
YVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATA    281 - 350
FEGHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG    351 - 420
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKK    421 - 490
YGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHA    491 - 560
TKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQL    561 - 630
CEDLIWNKDPEATEKLLRYAQTQGTGGKKVIQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKK    631 - 700
YPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDP    701 - 770
YQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM    771 - 840
IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIM    841 - 910
EEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFD    911 - 980
VWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEA    981 - 1050
AVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDD   1051 - 1120
YSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMW   1121 - 1190
RLADIEQSTGIRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL   1191 - 1260
GYDTD                                                                    1261 - 1265
//

Text Mined References (361)

PMID Year Title
26833750 2016 Dietary folate, one-carbon metabolism-related genes, and gastric cancer risk in Korea.
26595280 2015 Methionine synthase A2756G variation is associated with the risk of retinoblastoma in Iranian children.
26337056 2015 Joint associations of folate, homocysteine and MTHFR, MTR and MTRR gene polymorphisms with dyslipidemia in a Chinese hypertensive population: a cross-sectional study.
26334892 2015 Analysis of MTR and MTRR Polymorphisms for Neural Tube Defects Risk Association.
26299783 2015 Altered folate metabolism modifies cell proliferation and progesterone secretion in human placental choriocarcinoma JEG-3 cells.
26266420 2015 Homocysteine Metabolism Gene Polymorphisms (MTHFR C677T, MTHFR A1298C, MTR A2756G and MTRR A66G) Jointly Elevate the Risk of Folate Deficiency.
26196053 2015 Association between genetic polymorphisms in folate-related enzyme genes and infertile men with non-obstructive azoospermia.
26154858 2015 An Association Study Between Gene Polymorphisms of Folic Acid Metabolism Enzymes and Biochemical and Hormonal Parameters in Acromegaly.
26090795 2015 Associations between genetic variation in one-carbon metabolism and LINE-1 DNA methylation in histologically normal breast tissues.
26063524 2015 Gene polymorphisms as risk factors for predicting the cardiovascular manifestations in Marfan syndrome. Role of folic acid metabolism enzyme gene polymorphisms in Marfan syndrome.
25919635 2016 Apolipoprotein E genotype modulates effects of vitamin B12 and homocysteine on grey matter volume in Alzheimer's disease.
25822709 2015 Homocysteine and cognitive disorders of postmenopausal women measured by a battery of computer tests--central nervous system vital signs.
25801727 2015 The importance of MTHFR, MTR, MTRR and CSE expression levels in Caucasian women with preeclampsia.
25754229 2015 Association of folate metabolism gene polymorphisms and pulmonary embolism: A case-control study of West-Siberian population.
25730024 2015 Association between SNPs in genes involved in folate metabolism and preterm birth risk.
25578539 2015 Lack of association between genetic polymorphisms in three folate-related enzyme genes and male infertility in the Chinese population.
25531253 2014 Genetic variants of methionine metabolism and DNA methylation.
25366783 2014 Association between dietary intake of folate and MTHFR and MTR genotype with risk of breast cancer.
25293959 2014 Replication and exploratory analysis of 24 candidate risk polymorphisms for neural tube defects.
25277375 2014 Localization of folate metabolic enzymes, methionine synthase and 5,10-methylenetetrahydrofolate reductase in human placenta.
25217320 2014 Association of methylenetetrahydrofolate reductase and methionine synthase polymorphisms with breast cancer risk and interaction with folate, vitamin B6, and vitamin B 12 intakes.
25077679 2014 Quantitative assessment of the association between MS gene polymorphism and colorectal cancer risk.
25052622 2014 Maternal homocysteine in pregnancy and offspring birthweight: epidemiological associations and Mendelian randomization analysis.
24956146 2015 No association between MTR rs1805087 A > G polymorphism and non-Hodgkin lymphoma susceptibility: evidence from 11 486 subjects.
24595101 2014 Genetic variant in MTRR, but not MTR, is associated with risk of congenital heart disease: an integrated meta-analysis.
24166605 2013 Role of polymorphism of methyltetrahydrofolate-homocysteine methyltransferase (MTR) A2756G and breast cancer risk.
24150725 2013 The MTR 2756A>G polymorphism and maternal risk of birth of a child with Down syndrome: a case-control study and a meta-analysis.
24103477 2014 Methylenetetrahydrofolate reductase C677T and methionine synthase A2756G polymorphisms influence on leukocyte genomic DNA methylation level.
24087922 2014 Gene-environment interactions and the risk of childhood acute lymphoblastic leukemia: exploring the role of maternal folate genes and folic Acid fortification.
24051177 2013 Elevated homocysteine level in siblings of patients with schizophrenia.
23986219 The influence of genetic RFC1, MS and MTHFR polymorphisms on the risk of acute lymphoblastic leukemia relapse in children and the adverse effects of methotrexate.
23954866 2013 Gene-environment and gene-gene interactions of specific MTHFR, MTR and CBS gene variants in relation to homocysteine in black South Africans.
23906019 2014 Association between MTR A2756G polymorphism and childhood acute lymphoblastic leukemia: a meta-analysis.
23864153 2013 Association between MTHFR C677T, MTHFR A1298C and MS A2756G polymorphisms and risk of cervical intraepithelial neoplasia II/III and cervical cancer: a meta-analysis.
23845785 2013 Methionine synthase A2756G polymorphism and breast cancer risk: an up-to-date meta-analysis.
23825108 2013 Interaction between methionine synthase isoforms and MMACHC: characterization in cblG-variant, cblG and cblC inherited causes of megaloblastic anaemia.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23818366 Influence of polymorphisms in ERCC5, XPA and MTR DNA repair and synthesis genes in B-cell lymphoma risk. A case-control study in Spanish population.
23798577 2014 Genetic variants reducing MTR gene expression increase the risk of congenital heart disease in Han Chinese populations.
23613867 2013 Lack of association between methionine synthase A2756G polymorphism and digestive system cancer risk: evidence from 3,9327 subjects.
23595572 2013 MTHFR, MTR and MTRR polymorphisms and risk of chronic kidney disease in Japanese: cross-sectional data from the J-MICC Study.
23593229 2013 Methionine synthase A2756G polymorphism and risk of colorectal adenoma and cancer: evidence based on 27 studies.
23489792 2013 Interaction between maternal 5,10-methylenetetrahydrofolate reductase C677T and methionine synthase A2756G gene variants to increase the risk of fetal neural tube defects in a Shanxi Han population.
23459165 2013 Genetic polymorphisms in MTHFR (C677T, A1298C), MTR (A2756G) and MTRR (A66G) genes associated with pathological characteristics of prostate cancer in the Ecuadorian population.
23438943 2013 Association between the methionine synthase A2756G polymorphism and neural tube defect risk: a meta-analysis.
23430981 2013 Haplotype analysis of the folate-related genes MTHFR, MTRR, and MTR and migraine with aura.
23425389 2013 Meta-analyses on the association of MTR A2756G and MTRR A66G polymorphisms with neural tube defect risks in Caucasian children.
23415967 2013 Association of methionine synthase and thymidylate synthase genetic polymorphisms with idiopathic recurrent pregnancy loss.
23266814 2013 Association between MTR A2756G and MTRR A66G polymorphisms and maternal risk for neural tube defects: a meta-analysis.
23155246 2012 Interaction of MTHFR C677T and A1298C, and MTR A2756G gene polymorphisms in breast cancer risk in a population in Northeast Brazil.
22855024 2012 Polymorphisms in folate-metabolizing genes and risk of having an offspring with congenital anomalies in the West Siberian region of Russia: a case-control study.
22803112 2012 Role of polymorphic variants of MTR gene A2756G and SHMT1 gene C1420T in the development of prostatic cancer in residents of the Western Siberian Region of Russia.
22719222 2012 The polymorphisms in methylenetetrahydrofolate reductase, methionine synthase, methionine synthase reductase, and the risk of colorectal cancer.
22470444 2012 Polymorphisms in MTHFR, MS and CBS genes and homocysteine levels in a Pakistani population.
22453148 2012 Polymorphisms of MTHFR and MTR genes are not related to susceptibility to childhood ALL in North India.
22407825 2012 Methionine synthase and thymidylate synthase gene polymorphisms and colorectal adenoma risk: the self defense forces study.
22339686 2012 Folate gene polymorphisms MTR A2756G, MTRR A66G, and BHMT G742A and risk for coronary artery disease: a meta-analysis.
22236648 2012 Polymorphisms in the folate-metabolizing genes MTR, MTRR, and CBS and breast cancer risk.
22005284 2011 Importance of gene variants and co-factors of folate metabolic pathway in the etiology of idiopathic intellectual disability.
21956592 2012 Folate metabolism-related gene polymorphisms and susceptibility to primary liver cancer in North China.
21947961 2012 Hyperhomocysteinemia and related genetic polymorphisms correlate with ulcerative colitis in Chinese Han population in Central China [corrected].
21780915 2012 Three genetic polymorphisms of homocysteine-metabolizing enzymes and risk of coronary heart disease: a meta-analysis based on 23 case-control studies.
21775772 2011 Polymorphisms in folate-related enzyme genes in idiopathic infertile Brazilian men.
21774403 [Allelic polymorphism of MTHFR, MTR and MTRR genes in patients with cleft lip and/or palate and their mothers].
21737517 2012 A candidate gene approach to genetic contributors to the development of IgA nephropathy.
21643952 2012 Thymidylate synthase and methionine synthase polymorphisms are not associated with susceptibility to childhood acute lymphoblastic leukemia in Kurdish population from Western Iran.
21605004 2011 Influence of polymorphisms in MTHFR 677 C?T, TYMS 3R?2R and MTR 2756 A?G on NSCLC risk and response to platinum-based chemotherapy in advanced NSCLC.
21603981 2011 Gene polymorphisms involved in folate and methionine metabolism and increased risk of sporadic colorectal adenocarcinoma.
21567207 2011 Tetra primer ARMS-PCR relates folate/homocysteine pathway genes and ACE gene polymorphism with coronary artery disease.
21385350 2011 Hearing impairment risk and interaction of folate metabolism related gene polymorphisms in an aging study.
21349258 2011 Folate and choline metabolism gene variants and development of uterine cervical carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21092627 2010 [Associations of polymorphisms of methionine synthase A2756G and methionine synthase reductase G66A with the risks of coronary artery disease: a meta-analysis].
21070756 2011 Association of MTHFR, MTR, and MTRR polymorphisms with Parkinson's disease among ethnic Chinese in Taiwan.
21055808 2011 Polymorphisms in folate-metabolizing genes and risk of non-Hodgkin's lymphoma.
21045271 2010 The allele frequencies of three polymorphisms in genes involved in homocysteine metabolism in a group of unrelated healthy Singaporeans.
21045269 2010 Maternal gene polymorphisms involved in folate metabolism as risk factors for Down syndrome offspring in Southern Brazil.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20960050 2011 Dietary methyl donors, methyl metabolizing enzymes, and epigenetic regulators: diet-gene interactions and promoter CpG island hypermethylation in colorectal cancer.
20955826 2011 Germline variation in the MTHFR and MTRR genes determines the nadir of bone density in pediatric acute lymphoblastic leukemia: a prospective study.
20890936 2010 Maternal polymorphisms in folic acid metabolic genes are associated with nonsyndromic cleft lip and/or palate in the Brazilian population.
20883119 2011 Common polymorphisms in six genes of the methyl group metabolism pathway and obesity in European adolescents.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20737570 2010 Genetic variants in one-carbon metabolism-related genes contribute to NSCLC prognosis in a Chinese population.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20670920 2010 Association of genetic variation in cystathionine-beta-synthase and arsenic metabolism.
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615890 2010 A candidate gene study of folate-associated one carbon metabolism genes and colorectal cancer risk.
20549016 MTHFR, MTR, and MTRR polymorphisms in relation to p16INK4A hypermethylation in mucosa of patients with colorectal cancer.
20544798 2010 Genetic and lifestyle variables associated with homocysteine concentrations and the distribution of folate derivatives in healthy premenopausal women.
20532609 2010 Polymorphisms in one-carbon metabolism pathway genes, urinary arsenic profile, and urothelial carcinoma.
20490431 2010 5-Methyltetrahydrofolate-homocysteine methyltransferase gene polymorphism (MTR) and risk of head and neck cancer.
20466634 2010 [Folate gene polymorphism and the risk of Down syndrome pregnancies in young Chinese women].
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20447924 2010 Plasma folate, related genetic variants, and colorectal cancer risk in EPIC.
20445573 2011 Effects of MTHFR and MS gene polymorphisms on baseline blood pressure and Benazepril effectiveness in Chinese hypertensive patients.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20310006 2010 MTR polymorphic variant A2756G and retinoblastoma risk in Brazilian children.
20237949 2010 Genetic variants of folate and methionine metabolism and PCNSL incidence in a German patient population.
20235210 2010 Predictors for remission in rheumatoid arthritis patients: A systematic review.
20209990 2009 [Features of allele polymorphism of genes involved in homocysteine and folate metabolism in patients with atherosclerosis of the lower extremity arteries].
20180013 2010 Genetic polymorphisms in folate and alcohol metabolism and breast cancer risk: a case-control study in Thai women.
20111902 2010 Methionine synthase A2756G polymorphism and breast cancer risk: a meta-analysis involving 18,953 subjects.
20101025 2010 Genetic variation in the folate metabolic pathway and risk of childhood leukemia.
20085490 2010 Genetic variants of homocysteine/folate metabolism pathway and risk of inflammatory bowel disease: a synopsis and meta-analysis of genetic association studies.
20082058 2010 Transcobalamin-II variants, decreased vitamin B12 availability and increased risk of frailty.
20056620 2010 Vitamins B2 and B6 and genetic polymorphisms related to one-carbon metabolism as risk factors for gastric adenocarcinoma in the European prospective investigation into cancer and nutrition.
20031554 2008 Variants of folate metabolism genes and the risk of conotruncal cardiac defects.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19843671 2009 Genetic variants of methyl metabolizing enzymes and epigenetic regulators: associations with promoter CpG island hypermethylation in colorectal cancer.
19838916 2009 Dietary intake of folate, vitamin B2, vitamin B6, vitamin B12, genetic polymorphism of related enzymes, and risk of breast cancer: a case-control study in Japan.
19837268 2009 Polymorphisms in one-carbon metabolism pathway genes and risk for bladder cancer in a Tunisian population.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19826453 2010 Methionine synthase A2756G polymorphism and cancer risk: a meta-analysis.
19777601 2010 Variants of folate metabolism genes and risk of left-sided cardiac defects.
19776634 2009 Folate nutritional genetics and risk for hypertension in an elderly population sample.
19776626 2008 Polymorphisms in methionine synthase, methionine synthase reductase and serine hydroxymethyltransferase, folate and alcohol intake, and colon cancer risk.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19760026 2010 The effects of polymorphisms in methylenetetrahydrofolate reductase (MTHFR), methionine synthase (MTR), and methionine synthase reductase (MTRR) on the risk of cervical intraepithelial neoplasia and cervical cancer in Korean women.
19751277 2009 Folate-metabolizing genes in lymphoma patients from Sweden.
19737740 2010 Associations of folate and choline metabolism gene polymorphisms with orofacial clefts.
19729796 2009 Investigation of CBS, MTR, RFC-1 and TC polymorphisms as maternal risk factors for Down syndrome.
19706844 2009 Association of folate-pathway gene polymorphisms with the risk of prostate cancer: a population-based nested case-control study, systematic review, and meta-analysis.
19706843 2009 Alcohol consumption and genetic variation in methylenetetrahydrofolate reductase and 5-methyltetrahydrofolate-homocysteine methyltransferase in relation to breast cancer risk.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19683694 2009 Genetic association study of putative functional single nucleotide polymorphisms of genes in folate metabolism and spina bifida.
19649727 2010 Polymorphic variants of folate metabolism genes and the risk of laryngeal cancer.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19619240 2010 The relationship between homocysteine and genes of folate-related enzymes in migraine patients.
19588544 2009 Combined effect of NAT2, MTR and MTHFR genotypes and tobacco on bladder cancer susceptibility in Tunisian population.
19533788 2009 Evaluation of folate metabolism gene polymorphisms as risk factors for open and closed neural tube defects.
19504454 2009 [No association of the A2756G polymorphism of methionine synthase gene with nonsyndromic cleft lip with or without cleft palate].
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19427504 2009 Effect of common polymorphisms in folate uptake and metabolism genes on frequency of micronucleated lymphocytes in a South Australian cohort.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19394322 2009 Genetic and environmental influences on total plasma homocysteine and coronary artery disease (CAD) risk among South Indians.
19389261 2009 Dietary intake of folate, vitamin B6, and vitamin B12, genetic polymorphism of related enzymes, and risk of breast cancer: a case-control study in Brazilian women.
19353223 2009 Genetic variants of methionine metabolism and X-ALD phenotype generation: results of a new study sample.
19349296 2009 The impact of eNOS, MTR and MTHFR polymorphisms on renal graft survival in children and young adults.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19332728 2009 Pharmacogenetic analyses of a phase III trial in metastatic gastroesophageal adenocarcinoma with fluorouracil and leucovorin plus either oxaliplatin or cisplatin: a study of the arbeitsgemeinschaft internistische onkologie.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19283448 2010 Genetic polymorphisms involved in folate metabolism and concentrations of methylmalonic acid and folate on plasma homocysteine and risk of coronary artery disease.
19263808 2008 Plasma homocysteine and gene polymorphisms associated with the risk of hyperlipidemia in northern Chinese subjects.
19240236 2009 DNA promoter methylation in breast tumors: no association with genetic polymorphisms in MTHFR and MTR.
19177501 2009 Chromosomal aberrations in railroad transit workers: effect of genetic polymorphisms.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19159907 2009 Methotrexate in pediatric osteosarcoma: response and toxicity in relation to genetic polymorphisms and dihydrofolate reductase and reduced folate carrier 1 expression.
19124508 2009 Methionine synthase A2756G polymorphism interacts with alcohol and folate intake to influence the risk of colorectal adenoma.
19112534 2008 Lack of association of polymorphisms in homocysteine metabolism genes with pseudoexfoliation syndrome and glaucoma.
19074750 2009 Pharmacogenetic analyses of hematotoxicity in advanced gastric cancer patients receiving biweekly fluorouracil, leucovorin, oxaliplatin and docetaxel (FLOT): a translational study of the Arbeitsgemeinschaft Internistische Onkologie (AIO).
19064578 2008 No association of single nucleotide polymorphisms in one-carbon metabolism genes with prostate cancer risk.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19034339 2007 Synergistic effect of methyltetrahydrofolate reductase (MTHFR) C677T and A1298C polymorphism as risk modifiers of pediatric acute lymphoblastic leukemia.
19020309 2009 Polymorphisms in folate-related genes and risk of pediatric acute lymphoblastic leukemia.
19019492 2010 Genetic variation in homocysteine metabolism, cognition, and white matter lesions.
18996879 2008 Risk of colorectal cancer associated with the C677T polymorphism in 5,10-methylenetetrahydrofolate reductase in Portuguese patients depends on the intake of methyl-donor nutrients.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18988749 2009 MALDI-TOF MS genotyping of polymorphisms related to 1-carbon metabolism using common and mass-modified terminators.
18983896 2009 Association of maternal polymorphisms in folate metabolizing genes with chromosome damage and risk of Down syndrome offspring.
18844488 2008 Association between the 2756A> G variant in the gene encoding methionine synthase and myocardial infarction in Tunisian patients.
18843018 2008 Alcohol drinking and one-carbon metabolism-related gene polymorphisms on pancreatic cancer risk.
18842997 2008 Methionine-dependence phenotype in the de novo pathway in BRCA1 and BRCA2 mutation carriers with and without breast cancer.
18842806 2008 Associations between single nucleotide polymorphisms in folate uptake and metabolizing genes with blood folate, homocysteine, and DNA uracil concentrations.
18836720 2009 Prothrombotic polymorphisms, mutations, and their association with pediatric non-cardioembolic stroke in Asian-Indian patients.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18815869 2009 Polymorphisms of methylenetetrahydrofolate reductase and methionine synthase genes and bladder cancer risk: a case-control study with meta-analysis.
18801628 2008 Polymorphic variants of genes encoding MTHFR, MTR, and MTHFD1 and the risk of depression in postmenopausal women in Poland.
18799873 2008 Polymorphisms of homocysteine metabolism are associated with intracranial aneurysms.
18785313 2008 Functional polymorphisms of folate-metabolizing enzymes in relation to homocysteine concentrations in systemic lupus erythematosus.
18771981 2008 One-carbon metabolism enzyme polymorphisms and uteroplacental insufficiency.
18700049 2008 Methionine synthase A2756G polymorphism may predict ulcerative colitis and methylenetetrahydrofolate reductase C677T pancolitis, in Central China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18620331 2008 [Effect of polymorphisms on key enzymes in homocysteine metabolism, on plasma homocysteine level and on coronary artery-disease risk in a Tunisian population].
18607581 2008 Genetic determinants of methotrexate toxicity in rheumatoid arthritis patients: a study of polymorphisms affecting methotrexate transport and folate metabolism.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18498768 2008 The influence of MTR A2756G polymorphism on plasma homocysteine in young south Indians.
18485163 2008 Folic acid use in pregnancy and embryo selection.
18483342 2008 Functional polymorphisms in folate metabolism genes influence the risk of meningioma and glioma.
18447718 2008 Polymorphisms of methionine metabolism and susceptibility to meningioma formation: laboratory investigation.
18435414 2008 Polymorphisms in genes related to folate and cobalamin metabolism and the associations with complex birth defects.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
18406541 2008 Folate pathway genetic polymorphisms and susceptibility of central nervous system tumors in Thai children.
18386810 2008 Nutritional and genetic determinants of vitamin B and homocysteine metabolisms in neural tube defects: a multicenter case-control study.
18378576 2008 Coagulation gene predictors of photodynamic therapy for occult choroidal neovascularization in age-related macular degeneration.
18351371 2008 Impact of methylenetetrahydrofolate reductase (MTHFR) codon (677) and methionine synthase (MS) codon (2756) on risk of cervical carcinogenesis in North Indian population.
18329006 2008 Association analysis of methionine synthase gene 2756 A>G polymorphism and Alzheimer disease in a Chinese population.
18322994 2008 Common polymorphisms in the folate pathway predict efficacy of combination regimens containing methotrexate and sulfasalazine in early rheumatoid arthritis.
18281142 2008 Plasma homocysteine concentrations and the single nucleotide polymorphisms in the methionine synthase gene (MTR 2756A>G): Associations with the polycystic ovary syndrome An observational study.
18273817 2008 Genetic polymorphisms involved in folate metabolism and elevated plasma concentrations of homocysteine: maternal risk factors for Down syndrome in Brazil.
18249021 2008 Total homocysteine, B-vitamins and genetic polymorphisms in patients with classical phenylketonuria.
18222012 2008 Methylenetetrahydrofolate reductase 677 T allele protects against persistent HBV infection in West Africa.
18204969 2008 Polymorphisms in folate metabolizing enzymes and transport proteins and the risk of breast cancer.
18199722 2008 Dietary vitamin B6 intake and the risk of colorectal cancer.
18174236 2008 One-carbon metabolism-related gene polymorphisms and risk of breast cancer.
18060320 2008 The MTR A2756G polymorphism is associated with an increase of plasma homocysteine concentration in Brazilian individuals with Down syndrome.
18053808 2008 Distinct association of SLC19A1 polymorphism -43T>C with red cell folate levels and of MTHFR polymorphism 677C>T with plasma folate levels.
18034637 2008 Relationship between methionine synthase, methionine synthase reductase genetic polymorphisms and deep vein thrombosis among South Indians.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023275 2008 Evaluation of nutritional and genetic determinants of total homocysteine, methylmalonic acid and S-adenosylmethionine/S-adenosylhomocysteine values in Brazilian childbearing-age women.
18004208 2007 Predictive role of coagulation-balance gene polymorphisms in the efficacy of photodynamic therapy with verteporfin for classic choroidal neovascularization secondary to age-related macular degeneration.
17993766 2007 Are genetic variants of the methyl group metabolism enzymes risk factors predisposing to obesity?
17967524 2008 Association between polymorphisms of folate-metabolizing enzymes and risk of prostate cancer.
17925002 2008 Association of MTRR 66A>G polymorphism with superoxide dismutase and disease activity in patients with Crohn's disease.
17904392 2008 A high frequency of the MTHFR 677C>T polymorphism in Scottish women with epilepsy: possible role in pathogenesis.
17891500 2007 One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia.
17853476 2007 Fetal anticonvulsant syndromes and polymorphisms in MTHFR, MTR, and MTRR.
17822659 2007 Relation between plasma homocysteine, gene polymorphisms of homocysteine metabolism-related enzymes, and angiographically proven coronary artery disease.
17726616 2008 Polymorphisms in methionine synthase (A2756G) and cystathionine beta-synthase (844ins68) and susceptibility to carcinomas of the upper gastrointestinal tract.
17702010 2007 Polymorphisms in folate and homocysteine metabolizing genes and chromosome damage in mothers of Down syndrome children.
17691219 2007 Oxidative DNA damage and level of thiols as related to polymorphisms of MTHFR, MTR, MTHFD1 in Alzheimer's and Parkinson's diseases.
17683808 Translational regulation of human methionine synthase by upstream open reading frames.
17664238 2007 MTR 2756 A > G polymorphism is associated with the risk of systemic lupus erythematosus in the Polish population.
17655928 2008 Polymorphisms of methylenetetrahydrofolate reductase (MTHFR), methionine synthase (MTR), methionine synthase reductase (MTRR), and thymidylate synthase (TYMS) in multiple myeloma risk.
17636160 2007 The heritability of plasma homocysteine, and the influence of genetic variation in the homocysteine methylation pathway.
17617021 2007 Polymorphisms in genes involved in DNA repair and metabolism of xenobiotics in individual susceptibility to sporadic diffuse gastric cancer.
17611986 2007 2756GG genotype of methionine synthase reductase gene is more prevalent in rheumatoid arthritis patients treated with methotrexate and is associated with methotrexate-induced nodulosis.
17596206 2007 One-carbon metabolism-related gene polymorphisms and risk of head and neck squamous cell carcinoma: case-control study.
17595805 Breast cancer risk associated with multigenotypic polymorphisms in folate-metabolizing genes: a nested case-control study in Taiwan.
17590289 2007 Impact of air pollution and genotype variability on DNA damage in Prague policemen.
17581676 2007 Polymorphisms in genes MTHFR, MTR and MTRR are not risk factors for cleft lip/palate in South Brazil.
17574963 2007 Methylenetetrahydrofolate reductase and methionine synthase polymorphisms and risk of bladder cancer in a Tunisian population.
17553479 2007 A CBS haplotype and a polymorphism at the MSR gene are associated with cardiovascular disease in a Spanish case-control study.
17551576 2007 Role of C677T and A1298C MTHFR, A2756G MTR and -786 C/T eNOS gene polymorphisms in atrial fibrillation susceptibility.
17546637 2007 Polymorphisms involved in the folate metabolizing pathway and risk of multiple myeloma.
17533396 2007 Prognostic significance of folate metabolism polymorphisms for lung cancer.
17522601 2008 Association between decreased vitamin levels and MTHFR, MTR and MTRR gene polymorphisms as determinants for elevated total homocysteine concentrations in pregnant women.
17461517 2007 Influence of combined methionine synthase (MTR 2756A > G) and methylenetetrahydrofolate reductase (MTHFR 677C > T) polymorphisms to plasma homocysteine levels in Korean patients with ischemic stroke.
17454638 2007 Gene-gene interactions in the folate metabolic pathway influence the risk for acute lymphoblastic leukemia in children.
17450230 2007 Genetic polymorphisms influencing arsenic metabolism: evidence from Argentina.
17449906 2007 Genetic polymorphisms in one-carbon metabolism: associations with CpG island methylator phenotype (CIMP) in colon cancer and the modifying effects of diet.
17436311 2007 Large-scale population-based metabolic phenotyping of thirteen genetic polymorphisms related to one-carbon metabolism.
17417062 2007 MTHFD 1958G>A and MTR 2756A>G polymorphisms are associated with bipolar disorder and schizophrenia.
17412799 2007 Genetic and environmental influences on plasma homocysteine: results from a Danish twin study.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17339646 2007 Methylenetetrahydrofolate reductase 677C>T and methionine synthase 2756A>G mutations: no impact on survival, cognitive functioning, or cognitive decline in nonagenarians.
17311260 2007 Genetic polymorphisms in the one-carbon metabolism pathway and breast cancer risk: a population-based case-control study and meta-analyses.
17311259 2007 Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer.
17287836 2007 The methionine synthase polymorphism c.2756A>G (D919G) influences diastolic blood pressure.
17220339 2007 Genetic polymorphisms in folate metabolism and the risk of stomach cancer.
17160942 2006 [Study on the association of polymorphisms in homocysteine metabolism related enzymes with deep venous thrombosis].
17152488 2006 [Association between genetic polymorphisms in folate metabolic enzyme genes and colorectal cancer: a nested case-control study].
17151928 2007 Methyl group metabolism gene polymorphisms as modifier of breast cancer risk in Italian BRCA1/2 carriers.
17119116 2007 Gene-nutrient interactions among determinants of folate and one-carbon metabolism on the risk of non-Hodgkin lymphoma: NCI-SEER case-control study.
17119065 2006 The methionine synthase polymorphism c.2756A>G alters susceptibility to glioblastoma multiforme.
17074544 2006 Polymorphisms in folate metabolizing genes and risk for spontaneous preterm and small-for-gestational age birth.
17035141 2006 Neural tube defects and folate pathway genes: family-based association tests of gene-gene and gene-environment interactions.
17024475 2006 The methionine synthase reductase 66A>G polymorphism is a maternal risk factor for spina bifida.
17009228 2006 Pharmacogenomic and metabolic biomarkers in the folate pathway and their association with methotrexate effects during dosage escalation in rheumatoid arthritis.
16985020 2006 Folate metabolism polymorphisms influence risk of colorectal adenoma recurrence.
16947783 2006 Relationship between genetic variants in the adenosine pathway and outcome of methotrexate treatment in patients with recent-onset rheumatoid arthritis.
16894458 2006 Association of homocysteine (but not of MTHFR 677 C>T, MTR 2756 A>G, MTRR 66 A>G and TCN2 776 C>G) with ischaemic cerebrovascular disease in Sicily.
16861746 2006 Association study of four polymorphisms in three folate-related enzyme genes with non-obstructive male infertility.
16799656 2005 Genetic polymorphism of folate and methionine metabolizing enzymes and their susceptibility to malignant lymphoma.
16778415 2006 Impact of methionine synthase gene and methylenetetrahydrofolate reductase gene polymorphisms on the risk of sudden sensorineural hearing loss.
16769880 2006 Human methionine synthase reductase is a molecular chaperone for human methionine synthase.
16712703 2006 Maternal MTR genotype contributes to the risk of non-syndromic cleft lip and palate in the Polish population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16709328 2006 Polymorphisms in genes involved in folate metabolism as risk factors for oedematous severe childhood malnutrition: a hypothesis-generating study.
16580699 2006 A polymorphism of the methionine synthase reductase gene increases chromosomal damage in peripheral lymphocytes in smokers.
16485733 2006 Influence of methionine synthase (A2756G) and methionine synthase reductase (A66G) polymorphisms on plasma homocysteine levels and relation to risk of coronary artery disease.
16470748 2006 Study of four genes belonging to the folate pathway: transcobalamin 2 is involved in the onset of non-syndromic cleft lip with or without cleft palate.
16407418 2006 Polymorphisms in DNA repair genes modulate survival in cisplatin/gemcitabine-treated non-small-cell lung cancer patients.
16365025 2005 Risk of non-Hodgkin lymphoma associated with polymorphisms in folate-metabolizing genes.
16333305 2006 The prognostic significance of genetic polymorphisms (Methylenetetrahydrofolate Reductase C677T, Methionine Synthase A2756G, Thymidilate Synthase tandem repeat polymorphism) in multimodally treated oesophageal squamous cell carcinoma.
16328059 2006 Germ-line variants in methyl-group metabolism genes and susceptibility to DNA methylation in human breast cancer.
16284371 2005 Polymorphisms in the reduced folate carrier, thymidylate synthase, or methionine synthase and risk of colon cancer.
16268464 2005 Association of MTRRA66G polymorphism (but not of MTHFR C677T and A1298C, MTRA2756G, TCN C776G) with homocysteine and coronary artery disease in the French population.
16142417 2005 The methionine synthase polymorphism c.2756Aright curved arrow G (D919G) is relevant for disease-free longevity.
16115349 2005 No association between common polymorphisms in genes of folate and homocysteine metabolism and the risk of Down's syndrome among French mothers.
16051637 2005 One-carbon metabolism related gene polymorphisms interact with alcohol drinking to influence the risk of colorectal cancer in Japan.
16051610 2005 A B12-responsive internal ribosome entry site (IRES) element in human methionine synthase.
16013960 2005 Polymorphisms of genes controlling homocysteine levels and IQ score following the treatment for childhood ALL.
16006998 2005 Polymorphisms of methionine synthase and methionine synthase reductase and risk of lung cancer: a case-control analysis.
15979034 2005 Analysis of methionine synthase reductase polymorphisms for neural tube defects risk association.
15894670 2005 Polymorphisms of methionine synthase and methionine synthase reductase and risk of squamous cell carcinoma of the head and neck: a case-control analysis.
15889417 2005 Relationship between polymorphisms in genes involved in homocysteine metabolism and maternal risk for Down syndrome in Brazil.
15866085 2005 Polymorphisms of genes involved in homocysteine metabolism in preeclampsia and in uncomplicated pregnancies.
15820491 2005 Prevalence of myocardial infarction is related to hyperhomocysteinemia but not influenced by C677T methylenetetrahydrofolate reductase and A2756G methionine synthase polymorphisms in diabetic and non-diabetic subjects.
15797993 2005 Effect of polymorphisms in folate-related genes on in vitro methotrexate sensitivity in pediatric acute lymphoblastic leukemia.
15790587 2005 Gene-environment interactions between alcohol drinking and the MTHFR C677T polymorphism impact on esophageal cancer risk: results of a case-control study in Japan.
15719048 2005 [Study of serum Hcy and polymorphisms of Hcy metabolic enzymes in 192 families affected by congenital heart disease].
15612980 2005 Genetic polymorphisms predisposing to hyperhomocysteinemia in cardiac transplant patients.
15598777 2004 Colorectal cancer and the methylenetetrahydrofolate reductase 677C -> T and methionine synthase 2756A -> G polymorphisms: a study of 2,168 case-control pairs from the JANUS cohort.
15551285 2004 Methylenetetrahydrofolate reductase gene (MTHFR) polymorphisms and reduced risk of malignant lymphoma.
15514969 2005 Women with polymorphisms of methylenetetrahydrofolate reductase (MTHFR) and methionine synthase (MS) are less likely to have cervical intraepithelial neoplasia (CIN) 2 or 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15354395 2004 Methyltetrahydrofolate reductase polymorphism influences onset of Huntington's disease.
15205694 2004 [Effects of methionine synthase gene variation in parents on occurence of congenital heart disease in offspring].
15202865 2004 Polymorphism of methionine synthase gene in nuclear families of congenital heart disease.
15201366 2004 Association of IL-1 RN*2 allele and methionine synthase 2756 AA genotype with dementia severity of sporadic Alzheimer's disease.
15198953 2004 Polymorphisms and haplotypes in folate-metabolizing genes and risk of non-Hodgkin lymphoma.
15159311 2004 Common gene polymorphisms in the metabolic folate and methylation pathway and the risk of acute lymphoblastic leukemia and non-Hodgkin's lymphoma in adults.
15148588 2004 D919G polymorphism of methionine synthase gene is associated with blood pressure response to benazepril in Chinese hypertensive patients.
15138479 2004 The methionine synthase polymorphism D919G alters susceptibility to primary central nervous system lymphoma.
15117811 2004 Polymorphisms of folate metabolic genes and susceptibility to bladder cancer: a case-control study.
15111988 2004 Variable drug metabolism genes in Arab population.
15098482 2004 [Relations of methionine synthase gene variation with congenital heart disease].
15044114 2004 Gene-nutrient and gene-gene interactions of controlled folate intake by Japanese women.
14977639 2004 Polymorphisms in genes involved in folate metabolism and colorectal neoplasia: a HuGE review.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14744749 2004 Methionine synthase D919G polymorphism, folate metabolism, and colorectal adenoma risk.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12964809 2003 Low frequency of mutated methylenetetrahydrofolate reductase 677C-->T and 1298A-->C genetics single nucleotide polymorphisms (SNPs) in Sub-Saharan populations.
12923861 2003 Methionine synthase (MTR) 2756 (A --> G) polymorphism, double heterozygosity methionine synthase 2756 AG/methionine synthase reductase (MTRR) 66 AG, and elevated homocysteinemia are three risk factors for having a child with Down syndrome.
12893022 2003 The 2756A>G variant in the gene encoding methionine synthase: its relation with plasma homocysteine levels and risk of coronary heart disease in a Dutch case-control study.
12876480 2003 Methionine synthase polymorphism is a risk factor for Alzheimer disease.
12855226 2003 Interaction between common folate polymorphisms and B-vitamin nutritional status modulates homocysteine and risk for a thrombotic event.
12810988 [Mutations of MTHFR, MTR, MTRR genes as high risk factors for neural tube defects].
12716294 2002 Methionine Synthase Reductase Gene A66G Polymorphism is Associated with Risk of Colorectal Cancer.
12670934 2003 Nutritional modulation of gene expression and homocysteine utilization by vitamin B12.
12649067 2003 Homocysteine remethylation enzyme polymorphisms and increased risks for neural tube defects.
12648076 2003 Methionine synthase genetic polymorphism MS A2756G alters susceptibility to follicular but not diffuse large B-cell non-Hodgkin's lymphoma or multiple myeloma.
12642343 2003 Genetic and nutritional factors contributing to hyperhomocysteinemia in young adults.
12482550 2003 Effects of polymorphisms of methionine synthase and methionine synthase reductase on total plasma homocysteine in the NHLBI Family Heart Study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12375236 2002 Maternal genetic effects, exerted by genes involved in homocysteine remethylation, influence the risk of spina bifida.
12372672 2002 Essential hypertension in adolescents: association with insulin resistance and with metabolism of homocysteine and vitamins.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12154064 2002 Germ-line variants in methyl-group metabolism genes and susceptibility to DNA methylation in normal tissues and human primary tumors.
12111380 2002 Study of MTHFR and MS polymorphisms as risk factors for NTD in the Italian population.
12091127 2002 Methionine synthase polymorphism A2756G is associated with susceptibility for thromboembolic events and altered B vitamin/thiol metabolism.
12068375 2002 Hyperhomocysteinemia due to methionine synthase deficiency, cblG: structure of the MTR gene, genotype diversity, and recognition of a common mutation, P1173L.
12020105 2002 B-vitamin intake, metabolic genes, and colorectal cancer risk (United States).
12015064 2002 [Correlation analysis between plasma homocysteine level and polymorphism of homocysteine metabolism related enzymes in ischemic cerebrovascular or cardiovascular diseases].
11920232 2001 Methionine synthase A2756G and methylenetetrahydrofolate reductase A1298C polymorphisms are not risk factors for idiopathic venous thromboembolism.
11684547 2001 Increased prevalence of combined MTR and MTHFR genotypes among individuals with severely elevated total homocysteine plasma levels.
11672761 2001 Gene polymorphisms of homocysteine metabolism-related enzymes in Chinese patients with occlusive coronary artery or cerebral vascular diseases.
11592436 2001 Genetic defects as important factors for moderate hyperhomocysteinemia.
11584084 2001 Polymorphisms of key enzymes in homocysteine metabolism affect diet responsiveness of plasma homocysteine in healthy women.
11342450 2001 Association between polymorphisms of folate- and methionine-metabolizing enzymes and susceptibility to malignant lymphoma.
11257268 2001 Influence of a methionine synthase (D919G) polymorphism on plasma homocysteine and folate levels and relation to risk of myocardial infarction.
11204591 2001 Gene-environment and gene-gene interaction in the determination of plasma homocysteine levels in healthy middle-aged men.
11186937 2000 Comorbidity of 5,10-methylenetetrahydrofolate reductase and methionine synthase gene polymorphisms and risk for neural tube defects.
11074524 2000 Methyl group metabolism gene polymorphisms and susceptibility to prostatic carcinoma.
11074217 2000 Effect of heterozygosity for the methionine synthase 2756 A-->G mutation on the risk for recurrent cardiovascular events.
10791559 2000 5,10-Methylenetetrahydrofolate reductase gene variants and congenital anomalies: a HuGE review.
9683607 1998 Functionally null mutations in patients with the cblG-variant form of methionine synthase deficiency.
9587027 1998 Methylenetetrahydrofolate reductase and methionine synthase: biochemistry and molecular biology.
9242908 1997 Structure-based perspectives on B12-dependent enzymes.
9013615 1997 Human methionine synthase. cDNA cloning, gene localization, and expression.
8968737 1996 Human methionine synthase: cDNA cloning and identification of mutations in patients of the cblG complementation group of folate/cobalamin disorders.
8968736 1996 Defects in human methionine synthase in cblG patients.
8968735 1996 Cloning, mapping and RNA analysis of the human methionine synthase gene.
2407589 1990 Cobalamin-dependent methionine synthase.
2070814 1991 Lysosomal cobalamin accumulation in fibroblasts from a patient with an inborn error of cobalamin metabolism (cblF complementation group): visualization by electron microscope radioautography.
1583909 1992 Aging, chronic administration of ethanol, and acute exposure to nitrous oxide: effects on vitamin B12 and folate status in rats.
1517041 1992 The impact of iron deficiency on the flux of folates within the mammary gland.
1516297 1992 Methionine auxotrophy in inborn errors of cobalamin metabolism.