Property Summary

NCBI Gene PubMed Count 24
PubMed Score 64.12
PubTator Score 35.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Motor neuritis 3 4.398 2.2

Expression

Synonym

Accession P58546
Symbols V-1
GCDP

Gene

PDB

3AAA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26274321 T allele of rs17168525 in the 3'-UTR of myotrophin influence the level of myotrophin protein by interfering with let-7 binding.The T allele of MTPN rs17168525 is not associated with the left ventricular hypertrophy risk in essential hypertension patients.
16982933 a novel internal ribosome entry site-mediated mechanism may be responsible for the translation of unconventional self-Ag MPD6 in response to IFN-alpha stimulation.
11971907 myotrophin/V-1 is a regulatory protein for modulating the levels of activated NFkappaB dimers.

AA Sequence

MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT      1 - 70
PLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ                           71 - 118
//

Text Mined References (28)

PMID Year Title
26274321 2015 The Human Myotrophin Variant Attenuates MicroRNA-Let-7 Binding Ability but Not Risk of Left Ventricular Hypertrophy in Human Essential Hypertension.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20625546 2010 Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16982933 2006 An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
16895918 2006 Binding of myotrophin/V-1 to actin-capping protein: implications for how capping protein binds to the filament barbed end.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12031792 2002 Myotrophin-kappaB DNA interaction in the initiation process of cardiac hypertrophy.
11971907 2002 Myotrophin/V-1, a protein up-regulated in the failing human heart and in postnatal cerebellum, converts NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers.
11474205 2001 Assignment of myotrophin to human chromosome band 7q33-->q35 by in situ hybridization.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10329199 1999 cDNA sequence and characterization of the gene that encodes human myotrophin/V-1 protein, a mediator of cardiac hypertrophy.
8576259 1996 Cardiac myotrophin exhibits rel/NF-kappa B interacting activity in vitro.
8508536 1993 Myotrophin in human cardiomyopathic heart.
8428777 1993 Myotrophin induces early response genes and enhances cardiac gene expression.
1633812 1992 A rat cerebellar protein containing the cdc10/SWI6 motif.