Property Summary

NCBI Gene PubMed Count 1,307
PubMed Score 6900.55
PubTator Score 4386.41

Knowledge Summary

Patent (119,580)

TINX Plot

  Disease Sources (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Large intestine cancer 12 0.0 1.0
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Disease Target Count Z-score Confidence
Epilepsy 346 4.629 2.3
Intellectual disability 573 3.231 1.6
Disease Target Count
Smith-Kingsmore syndrome 1

Expression

Synonym

Accession P42345 Q4LE76 Q5TER1 Q6LE87 Q96QG3 Q9Y4I3
Symbols SKS
FRAP
FRAP1
FRAP2
RAFT1
RAPT1

Gene

PDB

4DRJ   4DRH   4DRI   4JSN   4JSP   4JSV   4JSX   4JT5   4JT6   5FLC   1FAP   1NSG   2FAP   2RSE   3FAP   4FAP   1AUE   2GAQ   2NPU  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid
S.cerevisiae OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
2660 confirmatory 8 / 108 / 1164 Cytometric Cell-Based qHTS for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells
2666 confirmatory 23 / 46 / 1211 High Content Imaging Cell-Based qHTS for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells
2667 confirmatory 52 / 124 / 1104 High Content Imaging Cell-Based qHTS for Inhibitors of the mTORC1 Signaling Pathway in MEF Cells
2668 confirmatory 49 / 222 / 1009 Cytometry Cell-Based qHTS for Inhibitors of the mTORC1 Signaling Pathway in MEF cells
2681 summary 0 / 0 / 0 Cell-Based qHTS for Inhibitors of the mTORC1 Signaling Pathway in MEF Cells: Summary
493208 confirmatory 342 / 2353 / 41294 Acumen qHTS Assay for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells: Sytravon
504465 confirmatory 214 / 1133 / 769 IN Cell qHTS Assay for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells: Sytravon
651784 confirmatory 168 / 297 / 318 Acumen qHTS Assay for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells: Hit Validation
651789 confirmatory 101 / 360 / 322 Acumen qHTS Assay for Inhibitors of the mTORC1 Signaling Pathway in WT MEF Cells: Hit Validation
651791 confirmatory 77 / 173 / 503 InCell qHTS Assay for Inhibitors of the mTORC1 Signaling Pathway in MEF (Tsc2-/-, p53-/-) Cells: Hit Validation
More...

Gene RIF (1240)

PMID Text
27095304 miR-3188 regulates nasopharyngeal carcinoma proliferation and chemosensitivity through a FOXO1-modulated positive feedback loop with mTOR-p-PI3K/AKT-c-JUN.
27077655 Ammonia induced autophagy by MTOR is mediated by DRD3.
27069150 MTORi use was associated with an increased risk of AG.
27055253 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
27048245 Our study demonstrates that the IGF1R/p110b/AKT/mTOR axis confers resistance to BYL719 in PIK3CA mutant breast cancers.
27012089 rapamysin, a suppressor of mTOR, causes completely different effects on tumor associated macrophages and cells of microglia.
26962683 results suggest that IL10-mediated inhibition of autophagy is facilitated by the cross talk between STAT3, AKT, and mTOR; in other words, the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26901106 direct connection between the cellular PI3K/AKT/mTOR signaling pathway, frequently activated in human hepatocarcinogenesis, and the enrichment of oncogenic transcription factors of the FBP family
26892465 Data suggest that simultaneous targeting of mammalian target of rapamycin (mTOR)- and adhesion kinase (FAK)-related pathways might offer a strategy for treating acute lymphoblastic leukemia (ALL).
26885978 expression of Akt and mTOR protein was enhanced in the endurance exercise group, whereas only the level of mTOR was elevated following Resistance training.
More...

AA Sequence

MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHH      1 - 70
IFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTF     71 - 140
TAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAV    141 - 210
AALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGE    211 - 280
RLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPS    281 - 350
PAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV    351 - 420
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLA    421 - 490
RAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKG    491 - 560
LAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLL    561 - 630
TPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVAL    631 - 700
NDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRP    701 - 770
YMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA    771 - 840
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSR    841 - 910
DASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFK    911 - 980
SLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQS    981 - 1050
TIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVK   1051 - 1120
LFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQI   1121 - 1190
FIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV   1191 - 1260
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELN   1261 - 1330
EDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYK   1331 - 1400
ELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTN   1401 - 1470
KDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDT   1471 - 1540
HDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPE   1541 - 1610
RREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD   1611 - 1680
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARC   1681 - 1750
FLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHA   1751 - 1820
SGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFR   1821 - 1890
SISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQL   1891 - 1960
LTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEG   1961 - 2030
LEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA   2031 - 2100
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPR   2101 - 2170
KLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWV   2171 - 2240
PHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSS   2241 - 2310
EVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLT   2311 - 2380
RMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYS   2381 - 2450
AGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD   2451 - 2520
VPTQVELLIKQATSHENLCQCYIGWCPFW                                            2521 - 2549
//

Text Mined References (1333)

PMID Year Title
27095304 2016 miR-3188 regulates nasopharyngeal carcinoma proliferation and chemosensitivity through a FOXO1-modulated positive feedback loop with mTOR-p-PI3K/AKT-c-JUN.
27077655 2016 Ammonia Induces Autophagy through Dopamine Receptor D3 and MTOR.
27069150 2016 Risk of Metabolic Complications in Patients with Solid Tumors Treated with mTOR inhibitors: Meta-analysis.
27055253 2016 Activation of the PI3K/mTOR Pathway following PARP Inhibition in Small Cell Lung Cancer.
27048245 2016 Activation of IGF1R/p110?/AKT/mTOR confers resistance to ?-specific PI3K inhibition.
27012089 2015 [REGULATION OF THE mTOR SIGNALING PATHWAY IN MACROPHAGES IN VARIOUS PATHOLOGIES].
26962683 2016 IL10 inhibits starvation-induced autophagy in hypertrophic scar fibroblasts via cross talk between the IL10-IL10R-STAT3 and IL10-AKT-mTOR pathways.
26901106 2016 PI3K/AKT/mTOR-dependent stabilization of oncogenic far-upstream element binding proteins in hepatocellular carcinoma cells.
26892465 2016 Synergism between the mTOR inhibitor rapamycin and FAK down-regulation in the treatment of acute lymphoblastic leukemia.
26885978 2016 Endurance Exercise Enhances the Effect of Strength Training on Muscle Fiber Size and Protein Expression of Akt and mTOR.
More...