1. Home
  2. Targets
  3. GPCR
  4. Class A rhodopsin like
  5. Melatonin receptor
  6. Melatonin receptor type 1B

Tclin Melatonin receptor type 1B

High affinity receptor for melatonin. Likely to mediates the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.

This gene encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This gene product is an integral membrane protein that is a G-protein coupled, 7-transmembrane receptor. It is found primarily in the retina and brain although this detection requires RT-PCR. It is thought to participate in light-dependent functions in the retina and may be involved in the neurobiological effects of melatonin. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 130
PubMed Score 92.38
PubTator Score 153.09

Knowledge Summary

Patent (1,026)

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6685 1.2e-15
Disease Target Count Z-score Confidence
Idiopathic scoliosis 29 5.004 2.5
diabetes mellitus 1663 4.568 2.3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.100 1.2e-15

Synonym

Accession P49286 Mel-1B-R
Symbols MT2
FGQTL2
MEL-1B-R

Gene

MTNR1B

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Bryan Roth 313 functional assay

 Collection (1)

 UniProt Keyword (12)

See all...

 GO Function (2)

 GO Component (2)

 GO Process (6)

 Compartment GO Term (12)

 MGI Phenotype (1)

 GWAS Trait (7)

 HCA RNA Cell Line (4)

Pathway (11)

See all...

Protein-protein Interaction (113)

GNAT3   CCL21   CXCL11   CCL25   CCL16   CXCL13   S1PR2   S1PR4   PENK   PDYN   PPY   NPY   PPBP   PF4   CXCL10   APP   SAA1   ADORA3   PYY   CXCL8   CCL5   ADRA2C   PMCH   ACKR3   NPY1R   SSTR1   SSTR2   SSTR4   CXCR5   SSTR3   SSTR5   OPRM1   OPRD1   OPRK1   OPRL1   CCR2   CXCL5   PTGER3   CXCL12   NMU   PIK3CG   NPY2R   CXCR3   NPY4R   P2RY4   CCR9   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   CCL20   CXCL6   PLCB2   PLCB3   CXCL9   PNOC   P2RY14   NPY5R   NMS   PIK3R6   TAS2R42   MT-RNR2   NPW   NPB   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   ARHGEF1   MCHR2   OXGR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   P2RY12   CXCL16   NMUR1   PLCB1   CCL28   HEBP1   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GPR55   CCL27  

Drug (4)

Structure of tasimelteon

tasimelteon
pKi 9.80

Structure of ramelteon

ramelteon
pKi 10.39

Structure of agomelatine

agomelatine
pKi 10.00

Structure of melatonin

melatonin
pEC50 9.70

Ligand (616)

Structure of CHEMBL366115

CHEMBL366115
pIC50 7.00

Structure of CHEMBL359561

CHEMBL359561
pKi 7.01

Structure of CHEMBL456646

CHEMBL456646
pIC50 7.01

Structure of CHEMBL241928

CHEMBL241928
pKi 7.02

Structure of CHEMBL3109562

CHEMBL3109562
pKi 7.02

Structure of CHEMBL183846

CHEMBL183846
pKi 7.02

Structure of CHEMBL19503

CHEMBL19503
pIC50 7.03

Structure of CHEMBL1813322

CHEMBL1813322
pKi 7.03

Structure of CHEMBL3260987

CHEMBL3260987
pKi 7.04

Structure of CHEMBL364835

CHEMBL364835
pKi 7.05

Structure of CHEMBL126005

CHEMBL126005
pKi 7.05

Structure of CHEMBL361854

CHEMBL361854
pKi 7.05

Structure of CHEMBL181457

CHEMBL181457
pKi 7.05

Structure of CHEMBL362097

CHEMBL362097
pKi 7.05

Structure of CHEMBL209711

CHEMBL209711
pKi 7.05

Structure of CHEMBL19442

CHEMBL19442
pIC50 7.05

Structure of CHEMBL3260986

CHEMBL3260986
pKi 7.06

Structure of CHEMBL123973

CHEMBL123973
pKi 7.06

Structure of CHEMBL365249

CHEMBL365249
pKi 7.07

Structure of CHEMBL1095522

CHEMBL1095522
pKi 7.07

Gene RIF (123)

PMID Text
26551672 Increases in islet MTNR1B expression is associated with type 2 diabetes susceptibility.
26519818 rs10830963 polymorphism was not associated with polycystic ovary syndrome in Han Chinese.
26440713 MTNR1B rs10830963 risk variant worsens the effect of melatonin on glucose tolerance
26431121 This systematic review was a comprehensive analysis of the currently available evidence, and found an overall significant association of rs4753426 polymorphism with the risk of--{REVIEW}
26345809 Authors investigated the association between rs4753426 single nucleotide polymorphisms in the melatonin receptor 1B (MTNR1B) gene and the risk of developing gestational diabetes mellitus (GDM).
25982863 Carriers of the G allele of MTNR1B rs10830963 are more likely to develop gestational diabetes than carriers of the C allele.
25939854 results indicate, for the first time, the presence of a functional circadian clock in the human myometrium with the hMTNR1B gene as a clock controlled target.
25922310 results obtained are suggestive of MTNR1B role in T2D etiology, they need to be confirmed with much larger sample sizes
25919927 It has been shown for the first time in obese youth that the MTNR1B variant is associated with an increased risk of IFG
25898821 MTNR1B rs4753426 and MTNR1B rs10830963 polymorphisms are not obviously associated with risk of AIS in either Asian populations or Caucasian populations.
25870980 rs10830963 MTNR1B polymorphism could be associated with individual differences in weight loss induced by a hypocaloric diet
25822611 Sections from paraffin-embedded normal tissue from 42 individuals, representing the different parts of the GI tract (n=39) and pancreas (n=3) were studied with immunohistochemistry using antibodies for melatonin, MT1 and MT2 receptors and serotonin.
25770211 cross-talk mediated via physical association of melatonin MT2 and 5-HT2C receptors into functional heteromers
25707907 these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.
25146448 our study found that the genetic polymorphisms rs10830963 and rs1387153 in MTNR1B and rs1801278 in IRS1 were associated with an increased risk of developing GDM.
25059758 The extent of receptor internalization for the human MT2 receptor is independent of the intrinsic efficacy of agonists and provide novel insights into the controversial relationship between intrinsic agonist efficacy and agonist-induced internalization
24728128 We conclude that variation in MTNR1B contributes to the absolute level of insulin secretion but not to differences in the temporal rate of change in insulin secretion.
24710643 the association between the common MTNR1B rs10830963 variation and fasting plasma glucose levels in BH population.
24335056 Our data indicate that variants in the circadian-related genes CRY2 and MTNR1B may affect long-term changes in energy expenditure, and dietary fat intake may modify the genetic effects.
24157813 genetic polymorphisms rs2119882 in melatonin receptor 1A (MTNR1A) and rs10830963 in melatonin receptor 1B (MTNR1B) are associated with an increased risk of developing gestational diabetes mellitus and insulin resistance in Han Chinese women
24142542 High expression for MT2 receptor is associated with gastric adenocarcinoma.
24117008 Suggest that physiological regulation of the melatonin receptors may result from complex and subtle mechanisms, a small difference in affinity between the active and inactive states of the receptor, and spontaneous coupling to G-proteins.
23840762 GCKR rs780094 variant confers high cross-ethnicity risk for the development of T2DM, while significant associations between GCK, MTNR1B and G6PC2 variants and T2DM risk are limited to Caucasians.
23798576 14 mutants with loss of Gi protein activation that associate with increased risk of type 2 diabete development (Review)
23761423 genetic association study in women in Finland: Data suggest that 2 SNPs in MTNR1B (rs10830963; rs1387153) are associated with gestational diabetes (and type 2 diabetes, as shown in previous studies); down-regulation of insulin secretion is related.
23611530 Genetics of MTNR1B point to impact of the melatonin signalling pathway for BP and left ventricular function.
23333399 Genetic inactivation of both transgenic MT1 and MT2 receptors produces an increase of wakefulness, likely as a result of reduced NREMS due to the lack of MT2 transgene receptors, and reduced REMS induced by the lack of MT1 transgene receptors.
23226241 The rs10830963 MTNR1B polymorphism is a risk factor for developing impaired glucose regulation and type 2 diabetes mellitus. (Meta-analysis)
22768333 The MTNR1B is likely to be involved in the regulation of glucose homeostasis during pregnancy.
22759724 Investigated whether genetic variants in MTNR1B were associated with delirium; none of the 5 single nucleotide polymorphisms tested were found to be associated with the occurrence of delirium.
22698518 These data showing the association of polymorphisms in the TPH2 and MTNR1B genes with the progressive subtypes of multiple sclerosis and disability suggest dysregulation in melatonin pathway
22686298 MT1 and MT2 expression is significantly reduced in preeclamptic compared with normotensive pregnancy placentas.
22450346 This study confirms the association of gestational diabetes mellitus with the rs10830963 variant in a sample of the Greek population.
22286214 Rare MTNR1B variants impairing melatonin receptor 1B function contribute to type 2 diabetes.
22138747 Results suggest that common genetic variation in the MTNR1a and 1b genes may contribute to breast cancer susceptibility, and that associations may vary by menopausal status.
22096510 Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women.
22017484 Description of the constitutive activity of cloned human melatonin receptors hMT(1) and hMT(2) and discovery of inverse agonists.
21809392 Data indicate that melatonin receptors MT1 and MT2 expression levels decreased in both early and advanced stages of tumors in males.
21701235 The rs10830963 polymorphism in MTNR1B was associated with increased fasting glucose and risk of impaired fasting glucose in Chinese children and adolescents.
21658282 There were significant associations between the two genetic variants (rs10830963 and rs1387153) of the melatonin receptor 1B gene and gestational diabetes mellitus.
21558052 There is a strong association of rs1374645 polymorphism with low fasting blood glucose levels in the low BMI group compared to the high BMI group.
21515849 Children and adolescents carrying glucose-raising alleles of G6PC2, MTNR1B, GCK, and GLIS3 also showed reduced beta-cell function, as indicated by homeostasis model assessment of beta-cell function.
21470412 The rs3781637 A/G polymorphism of the MTNR1B gene is associated with type 2 diabetes, plasma, total cholesterol and LDL-C levels in the Han Chinese population.
21380592 There is no effect by the common gene variant rs10830963 of the melatonin receptor 1B on the association between sleep disturbances and type 2 diabetes.
21366812 The G-allele of rs10830693 in the MTNR1B gene was significantly related to glucose levels, while an impact of this genetic variant on the changes in glucose metabolism in children participating in a lifestyle intervention was not observable.
21353709 The results of this study suggested that the Single nucleotide polymorphisms MT(2) receptor gene influence the risk of recurrent depressive disorder.
21308753 we concluded that MTNR1B SNP is not associated with either adolescent idiopathic scoliosis predisposition or curve severity in Japanese.
21228692 Data suggest that the genetic effect of promoter polymorphisms of BMP4, IL6, leptin, MMP3, and MTNR1B can be synergistic for susceptibility to AIS.
21059861 This is the first single study, replicating the association between the MTNR1B locus and diabetes-related traits in overweight and obese children and adolescents.
21059861 Observational study of gene-disease association. (HuGE Navigator)
21036910 Observational study of gene-disease association. (HuGE Navigator)
20959387 SNPs within the MTNR1B gene are associated with polycystic ovary syndrome in Han Chinese women.
20959387 Observational study of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20858683 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20802253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20733416 No significant differences were found in the hMel-1B and RORa receptors in patients with adolescent idiopathic scoliosis compared with controls
20726823 Melatonin has a modulating effect on dopaminergic neurotransmission in the brain. Read More: http://informahealthcare.com/doi/full/10.3109/15622975.2010.496870
20726823 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20668700 Study showed that SNPs from GCK, G6PC2 and MTNR1B modulated the fasting glucose levels in the normoglycaemic population while SNPs from G6PC2 and GCKR was associated with type 2 diabetes.
20668700 Observational study of gene-disease association. (HuGE Navigator)
20657642 Study identified six non-synonymous mutations for MTNR1A and ten for MTNR1B in autism spectrum disorders patients . The majority of these variations altered receptor function.
20657642 Observational study of gene-disease association. (HuGE Navigator)
20628598 Common variants of MTNR1B, G6PC2 and GCK are associated with elevated FPG and impaired insulin secretion, both individually and jointly, suggesting that these risk alleles may precipitate or perpetuate hyperglycemia in predisposed individuals.
20628598 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20597807 variants in MTNR1B confer pancreatic beta-cell dysfunction
20536959 The common variant in MTNR1B confers the risk of Type 2 diabetes and modulates FPG in both the Han Chinese and European populations.
20536959 Observational study of gene-disease association. (HuGE Navigator)
20490451 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20398260 A common variant in MTNR1B was associated with fasting glucose, HbA1C and HOMA-B but not with sleep status in Chinese Hans from Shanghai.
20398260 Observational study of gene-disease association. (HuGE Navigator)
20377855 Observational study of gene-disease association. (HuGE Navigator)
20207350 MTNR1B contributes to the phenotypic expression of polycystic ovary syndrome.
20207350 Observational study of gene-disease association. (HuGE Navigator)
20200315 MTNR1B variations associate with with increased body mass and decreased fasting blood glucose in Europeans.
20200315 Observational study of gene-disease association. (HuGE Navigator)
20185807 Observational study of gene-disease association. (HuGE Navigator)
20110911 The results demonstrate a down-regulation of melatonin receptors in regions affected by Parkinson disease, suggesting their possible involvement in the disease process.
20050988 MT(2) melatonin receptor may have undergone a selective pressure in response to global variation in sunshine duration. selection of rs4753426C allele would insure that carriers adapted to local daily and seasonal rhythms more quickly
20050988 Observational study of genotype prevalence. (HuGE Navigator)
19937311 Fasting glucose association at MTNR1b is replicable across ethnic groups, although ethnic diversity in the pattern and strength of linkage disequilibrium exists.
19937311 Observational study of gene-disease association. (HuGE Navigator)
19933996 Observational study of gene-disease association. (HuGE Navigator)
19833888 Observational study of gene-disease association. (HuGE Navigator)
19808892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19741166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19651812 Genetic variation in this protein may contribute to abnormal glucose metabolism and related metabolic disturbances among Indian Asians.
19651812 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19533084 Variations and single-nucleotide polymorphisms are associated in variations in fasting plasma glucose and an increased risk of type 2 diabetes.
19533084 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19502414 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19455304 Genetic variation of MTNR1B is associated with defective early insulin response and decreased beta cell glucose sensitivity.
19324940 G-allele increases risk of type 2 diabetes and associates with estimates of beta-cell dysfunction and hepatic insulin resistance.
19324940 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19324937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19241057 A common variant in the MTNR1B gene is associated with an increased risk of type 2 diabetes and increased fasting plasma glucose in Han Chinese.
19241057 Observational study of gene-disease association. (HuGE Navigator)
19184136 Observational study of gene-disease association. (HuGE Navigator)
19088850 Common genetic variation within MTNR1B determines glucose-stimulated insulin secretion and plasma glucose concentrations.
19060910 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060909 These data suggest a possible link between circadian rhythm regulation and glucose homeostasis through the melatonin signaling pathway.
19060909 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19060908 These data suggest that the circulating hormone melatonin, which is predominantly released from the pineal gland in the brain, is involved in the pathogenesis of type 2 diabetes.
19060908 Observational study of gene-disease association. (HuGE Navigator)
19060907 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19060907 Variants in the gene encoding melatonin receptor 1B (MTNR1B) were consistently associated with fasting glucose across all ten studies.
19001515 Melatonin synergizes with oxytocin to promote myometrial cell contractions in vitro, which in vivo would promote coordinated and forceful contractions of the late term pregnant uterus necessary for parturition.
18544139 role of proline residues in structure & function of the MT2 receptor; results indicate residues P174, P212 & P266 are important for ligand binding and/or signaling of the MT2 receptor
18363673 MT2 receptor is involved in mediating the insulin- and cGMP-inhibiting action of melatonin in panreatic beta cells.
18341518 Truncation of the C-terminal tail of both receptors (MT(1)Y7.64 and MT(2)Y7.64) inhibited internalization as well as the cAMP response, suggesting the importance of the C-terminal tail in these receptor functions.
18001530 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17632395 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17632395 Polymorphisms of the promoter of MTNR1B gene were associated with AIS, but not with the curve severity in AIS patients. This suggested that MTNR1B was an AIS predisposition gene.
17316165 MT(2) was localized to ganglion and bipolar cells in the inner nuclear layer, and to the inner segments of the photoreceptor cells, cellular processes in inner and outer plexiform layers . In AD patients intensity of MT(2)-staining was decreased.
17108395 Observational study of gene-disease association. (HuGE Navigator)
16098099 Observational study of gene-disease association. (HuGE Navigator)
16098099 melatonin receptor type 1B polymorphism is associated with the presence of rheumatoid factor in Korean rheumatoid arthritis
15913560 residues N268 and A275 in TM6 as well as residues V291 and L295 in TM7 are essential for 2-iodomelatonin binding to the MT2 receptor
12767050 Expression in cultured skin cells.
12088876 Melatonin inhibited ERalpha mRNA expression & enhanced induction of pancreatic spasmolytic polypeptide in MT(1)-transfected breast cancer cells, suggesting a role for the MT(1) receptor in melatonin-regulated growth-suppression & gene-modulation.
11940583 Monitoring of ligand-independent dimerization and ligand-induced conformational changes of melatonin receptors in living cells by bioluminescence resonance energy transfer (melatonin receptor 2)

AA Sequence 

MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLLVILSVLRNRK      1 - 70
LRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVMGLSVIGSVFNITAIAINRYC     71 - 140
YICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGSLEYDPRIYSCTFIQTASTQYTAAVVVIHFL    141 - 210
LPIAVVSFCYLRIWVLVLQARRKAKPESRLCLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQE    211 - 280
MAPQIPEGLFVTSYLLAYFNSCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAP    281 - 350
PIIGVQHQADAL                                                              351 - 362
//

Text Mined References (130)

PMID Year Title
26551672 2015 Genetic fine mapping and genomic annotation defines causal mechanisms at type 2 diabetes susceptibility loci.
26519818 2015 Family association study between melatonin receptor gene polymorphisms and polycystic ovary syndrome in Han Chinese.
26514267 2016 Protein interactome mining defines melatonin MT1 receptors as integral component of presynaptic protein complexes of neurons.
26440713 2015 Common type 2 diabetes risk variant in MTNR1B worsens the deleterious effect of melatonin on glucose tolerance in humans.
26431121 The Association of rs4753426 Polymorphism in the Melatonin Receptor 1B (MTNR1B) Gene and Susceptibility to Adolescent Idiopathic Scoliosis: A Systematic Review and Meta-analysis.
26345809 2015 Association between the rs4753426 polymorphism in MTNR1B with fasting plasma glucose level and pancreatic ?-cell function in gestational diabetes mellitus.
25982863 2015 The MTNR1B gene polymorphism rs10830963 is associated with gestational diabetes in a Brazilian population.
25939854 2015 Circadian clock regulation of melatonin MTNR1B receptor expression in human myometrial smooth muscle cells.
25922310 2015 MTNR1B gene polymorphisms and susceptibility to Type 2 Diabetes: A pilot study in South Indians.
25919927 2015 A common variant in the MTNR1b gene is associated with increased risk of impaired fasting glucose (IFG) in youth with obesity.
25898821 2015 The polymorphisms of melatonin receptor 1B gene (MTNR1B) (rs4753426 and rs10830963) and susceptibility to adolescent idiopathic scoliosis: a meta-analysis.
25870980 2014 Gene-Gene Interplay and Gene-Diet Interactions Involving the MTNR1B rs10830963 Variant with Body Weight Loss.
25833399 2015 Placental melatonin system is present throughout pregnancy and regulates villous trophoblast differentiation.
25822611 2015 Human gastroenteropancreatic expression of melatonin and its receptors MT1 and MT2.
25770211 2015 Convergence of melatonin and serotonin (5-HT) signaling at MT2/5-HT2C receptor heteromers.
25707907 2015 Season-dependent associations of circadian rhythm-regulating loci (CRY1, CRY2 and MTNR1B) and glucose homeostasis: the GLACIER Study.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25146448 2014 Relationship between melatonin receptor 1B and insulin receptor substrate 1 polymorphisms with gestational diabetes mellitus: a systematic review and meta-analysis.
25059758 2014 Pharmacological characterization of a highly selective and potent partial agonist of the MT? melatonin receptor.
24728128 2014 Genetic variation in MTNR1B is associated with gestational diabetes mellitus and contributes only to the absolute level of beta cell compensation in Mexican Americans.
24710643 2014 Effects of melatonin receptor 1B gene variation on glucose control in population from Bosnia and Herzegovina.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24335056 2014 Variants in glucose- and circadian rhythm-related genes affect the response of energy expenditure to weight-loss diets: the POUNDS LOST Trial.
24157813 2013 Association between genetic variations in MTNR1A and MTNR1B genes and gestational diabetes mellitus in Han Chinese women.
24142542 2014 Expression of MT2 receptor in patients with gastric adenocarcinoma and its relationship with clinicopathological features.
24117008 2014 Melatonin MT? and MT? receptors display different molecular pharmacologies only in the G-protein coupled state.
23903356 2013 Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies.
23840762 2013 Large scale meta-analyses of fasting plasma glucose raising variants in GCK, GCKR, MTNR1B and G6PC2 and their impacts on type 2 diabetes mellitus risk.
23798576 2013 Minireview: Toward the establishment of a link between melatonin and glucose homeostasis: association of melatonin MT2 receptor variants with type 2 diabetes.
23761423 2013 Association of risk variants for type 2 diabetes and hyperglycemia with gestational diabetes.
23719583 2013 Genome-wide association study identifies a region on chromosome 11q14.3 associated with late rectal bleeding following radiation therapy for prostate cancer.
23611530 2013 Genetics of melatonin receptor type 2 is associated with left ventricular function in hypertensive patients treated according to guidelines.
23575436 2013 New susceptibility loci in MYL2, C12orf51 and OAS1 associated with 1-h plasma glucose as predisposing risk factors for type 2 diabetes in the Korean population.
23333399 2013 Sleep-wake characterization of double MT?/MT? receptor knockout mice and comparison with MT? and MT? receptor knockout mice.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23226241 2012 Association between the melatonin receptor 1B gene polymorphism on the risk of type 2 diabetes, impaired glucose regulation: a meta-analysis.
22768333 2012 Association of genetic variants of melatonin receptor 1B with gestational plasma glucose level and risk of glucose intolerance in pregnant Chinese women.
22759724 2012 Polymorphisms in the melatonin receptor 1B gene and the risk of delirium.
22754043 2012 A genome-wide association study of caffeine-related sleep disturbance: confirmation of a role for a common variant in the adenosine receptor.
22698518 2012 Melatonin pathway genes are associated with progressive subtypes and disability status in multiple sclerosis among Finnish patients.
22686298 2012 Placental melatonin production and melatonin receptor expression are altered in preeclampsia: new insights into the role of this hormone in pregnancy.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22508271 2012 Fasting glucose GWAS candidate region analysis across ethnic groups in the Multiethnic Study of Atherosclerosis (MESA).
22450346 The rs10830963 variant of melatonin receptor MTNR1B is associated with increased risk for gestational diabetes mellitus in a Greek population.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22286214 2012 Rare MTNR1B variants impairing melatonin receptor 1B function contribute to type 2 diabetes.
22233651 2012 A genome-wide association study of gestational diabetes mellitus in Korean women.
22138747 2012 Melatonin pathway genes and breast cancer risk among Chinese women.
22096510 2011 Association of six single nucleotide polymorphisms with gestational diabetes mellitus in a Chinese population.
22017484 2012 Description of the constitutive activity of cloned human melatonin receptors hMT(1) and hMT(2) and discovery of inverse agonists.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21809392 2012 Gender-related invasion differences associated with mRNA expression levels of melatonin membrane receptors in colorectal cancer.
21701235 2011 Association of the rs10830963 polymorphism in MTNR1B with fasting glucose levels in Chinese children and adolescents.
21658282 2011 Melatonin receptor 1 B polymorphisms associated with the risk of gestational diabetes mellitus.
21558052 2012 A low frequency variant within the GWAS locus of MTNR1B affects fasting glucose concentrations: genetic risk is modulated by obesity.
21515849 2011 Association of genetic Loci with glucose levels in childhood and adolescence: a meta-analysis of over 6,000 children.
21470412 2011 A common polymorphism rs3781637 in MTNR1B is associated with type 2 diabetes and lipids levels in Han Chinese individuals.
21380592 2011 No effect by the common gene variant rs10830963 of the melatonin receptor 1B on the association between sleep disturbances and type 2 diabetes: results from the Nord-Trøndelag Health Study.
21366812 2011 Relationship between MTNR1B (melatonin receptor 1B gene) polymorphism rs10830963 and glucose levels in overweight children and adolescents.
21353709 2011 Single nucleotide polymorphisms and mRNA expression for melatonin MT(2) receptor in depression.
21308753 2011 Lack of association between adolescent idiopathic scoliosis and previously reported single nucleotide polymorphisms in MATN1, MTNR1B, TPH1, and IGF1 in a Japanese population.
21228692 2011 Association study of BMP4, IL6, Leptin, MMP3, and MTNR1B gene promoter polymorphisms and adolescent idiopathic scoliosis.
21059861 2011 Association of a MTNR1B gene variant with fasting glucose and HOMA-B in children and adolescents with high BMI-SDS.
21036910 2011 Association of a fasting glucose genetic risk score with subclinical atherosclerosis: The Atherosclerosis Risk in Communities (ARIC) study.
20959387 2011 Association of rs10830963 and rs10830962 SNPs in the melatonin receptor (MTNR1B) gene among Han Chinese women with polycystic ovary syndrome.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20879858 2010 Impact of single nucleotide polymorphisms and of clinical risk factors on new?onset diabetes mellitus in HIV?infected individuals.
20859254 2010 Molecular organization and dynamics of the melatonin MT? receptor/RGS20/G(i) protein complex reveal asymmetry of receptor dimers for RGS and G(i) coupling.
20858683 2010 Common variants at 10 genomic loci influence hemoglobin A?(C) levels via glycemic and nonglycemic pathways.
20802253 2010 Glycemia determines the effect of type 2 diabetes risk genes on insulin secretion.
20733416 2010 Evaluation of GPR50, hMel-1B, and ROR-alpha melatonin-related receptors and the etiology of adolescent idiopathic scoliosis.
20726823 2011 Analysis of genetic variations in the human melatonin receptor (MTNR1A, MTNR1B) genes and antipsychotics-induced tardive dyskinesia in schizophrenia.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20668700 2010 Effects of GCK, GCKR, G6PC2 and MTNR1B variants on glucose metabolism and insulin secretion.
20657642 2010 Identification of pathway-biased and deleterious melatonin receptor mutants in autism spectrum disorders and in the general population.
20628598 2010 Common polymorphisms in MTNR1B, G6PC2 and GCK are associated with increased fasting plasma glucose and impaired beta-cell function in Chinese subjects.
20597807 2010 Genetic variants in MTNR1B affecting insulin secretion.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20536959 2010 Two susceptible diabetogenic variants near/in MTNR1B are associated with fasting plasma glucose in a Han Chinese cohort.
20490451 2010 Type 2 diabetes risk alleles near ADCY5, CDKAL1 and HHEX-IDE are associated with reduced birthweight.
20398260 2010 MTNR1B rs10830963 is associated with fasting plasma glucose, HbA1C and impaired beta-cell function in Chinese Hans from Shanghai.
20377855 2010 Mutation screening of melatonin-related genes in patients with autism spectrum disorders.
20207350 2010 Common genetic variation in MTNR1B is associated with serum testosterone, glucose tolerance, and insulin secretion in polycystic ovary syndrome patients.
20200315 2010 MTNR1B G24E variant associates With BMI and fasting plasma glucose in the general population in studies of 22,142 Europeans.
20185807 2010 Detailed physiologic characterization reveals diverse mechanisms for novel genetic Loci regulating glucose and insulin metabolism in humans.
20110911 2010 Melatonin MT1 and MT2 receptor expression in Parkinson's disease.
20081858 2010 New genetic loci implicated in fasting glucose homeostasis and their impact on type 2 diabetes risk.
20050988 2010 Association of disease-predisposition polymorphisms of the melatonin receptors and sunshine duration in the global human populations.
19937311 2010 Common variants at the GCK, GCKR, G6PC2-ABCB11 and MTNR1B loci are associated with fasting glucose in two Asian populations.
19933996 2010 Examination of all type 2 diabetes GWAS loci reveals HHEX-IDE as a locus influencing pediatric BMI.
19833888 2010 Gene variants in the novel type 2 diabetes loci CDC123/CAMK1D, THADA, ADAMTS9, BCL11A, and MTNR1B affect different aspects of pancreatic beta-cell function.
19808892 2010 Combined risk allele score of eight type 2 diabetes genes is associated with reduced first-phase glucose-stimulated insulin secretion during hyperglycemic clamps.
19741166 2009 Common genetic determinants of glucose homeostasis in healthy children: the European Youth Heart Study.
19651812 2009 Common genetic variation near melatonin receptor MTNR1B contributes to raised plasma glucose and increased risk of type 2 diabetes among Indian Asians and European Caucasians.
19533084 2009 Combined effects of single-nucleotide polymorphisms in GCK, GCKR, G6PC2 and MTNR1B on fasting plasma glucose and type 2 diabetes risk.
19502414 2009 Association of 18 confirmed susceptibility loci for type 2 diabetes with indices of insulin release, proinsulin conversion, and insulin sensitivity in 5,327 nondiabetic Finnish men.
19455304 2009 Common genetic variation in the melatonin receptor 1B gene (MTNR1B) is associated with decreased early-phase insulin response.
19324940 2009 G-allele of intronic rs10830963 in MTNR1B confers increased risk of impaired fasting glycemia and type 2 diabetes through an impaired glucose-stimulated insulin release: studies involving 19,605 Europeans.
19324937 2009 Previously associated type 2 diabetes variants may interact with physical activity to modify the risk of impaired glucose regulation and type 2 diabetes: a study of 16,003 Swedish adults.
19241057 2009 A common variant in MTNR1B, encoding melatonin receptor 1B, is associated with type 2 diabetes and fasting plasma glucose in Han Chinese individuals.
19184136 2009 Examination of association of genes in the serotonin system to autism.
19088850 2008 Polymorphisms within the novel type 2 diabetes risk locus MTNR1B determine beta-cell function.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
19060909 2009 A variant near MTNR1B is associated with increased fasting plasma glucose levels and type 2 diabetes risk.
19060908 2009 Common variant in MTNR1B associated with increased risk of type 2 diabetes and impaired early insulin secretion.
19060907 2009 Variants in MTNR1B influence fasting glucose levels.
19001515 2009 Melatonin synergizes with oxytocin to enhance contractility of human myometrial smooth muscle cells.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18544139 2008 The role of proline residues in the structure and function of human MT2 melatonin receptor.
18363673 2008 Involvement of the cGMP pathway in mediating the insulin-inhibitory effect of melatonin in pancreatic beta-cells.
18341518 2008 C-terminal domains within human MT1 and MT2 melatonin receptors are involved in internalization processes.
18001530 2007 [Is polymorphism of CALM1 gene or growth hormone receptor gene associated with susceptibility to adolescent idiopathic scoliosis?].
17632395 2007 Melatonin receptor 1B (MTNR1B) gene polymorphism is associated with the occurrence of adolescent idiopathic scoliosis.
17316165 2007 The MT2 melatonin receptor subtype is present in human retina and decreases in Alzheimer's disease.
17108395 2006 The role of melatonin receptor 1B gene (MTNR1B) in adolescent idiopathic scoliosis--a genetic association study.
16098099 2005 Positive relationship between melatonin receptor type 1B polymorphism and rheumatoid factor in rheumatoid arthritis patients in the Korean population.
15913560 2005 Ligand binding to the human MT2 melatonin receptor: the role of residues in transmembrane domains 3, 6, and 7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15266022 2004 Preferential formation of MT1/MT2 melatonin receptor heterodimers with distinct ligand interaction properties compared with MT2 homodimers.
12767050 2003 Functional activity of serotoninergic and melatoninergic systems expressed in the skin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12088876 2002 MT(1) melatonin receptor overexpression enhances the growth suppressive effect of melatonin in human breast cancer cells.
11940583 2002 Monitoring of ligand-independent dimerization and ligand-induced conformational changes of melatonin receptors in living cells by bioluminescence resonance energy transfer.
11606436 2001 Cyclical regulation of GnRH gene expression in GT1-7 GnRH-secreting neurons by melatonin.
10696804 2000 Genetic polymorphisms of human melatonin 1b receptor gene in circadian rhythm sleep disorders and controls.
10612428 1999 Melatonin receptor mRNA expression in human granulosa cells.
8988899 1997 Melatonin in humans.
8647286 1996 Cloning of a melatonin-related receptor from human pituitary.
7568007 1995 Molecular characterization of a second melatonin receptor expressed in human retina and brain: the Mel1b melatonin receptor.