Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.41
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.4e-04
non primary Sjogren syndrome sicca 840 2.6e-02
Disease Target Count Z-score Confidence
Centronuclear myopathy 21 3.572 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.4e-04
non primary Sjogren syndrome sicca -1.100 2.6e-02

Gene RIF (2)

PMID Text
26143924 Here, the crystal structure of the phosphatase domain of MTMR8 is reported.
24282552 East African population that gave rise to non-Africans underwent a selective sweep affecting the subcentromeric region where MTMR8 is located

AA Sequence

MDHITVPKVENVKLVDRYVSKKPANGILYLTATHLIYVEASGAARKETWIALHHIATVEKLPITSLGCPL      1 - 70
TLRCKNFRVAHFVLDSDLVCHEVYISLLKLSQPALPEDLYAFSYNPKSSKEMRESGWKLIDPISDFGRMG     71 - 140
IPNRNWTITDANRNYEICSTYPPEIVVPKSVTLGTVVGSSKFRSKERVPVLSYLYKENNAAICRCSQPLS    141 - 210
GFYTRCVDDELLLEAISQTNPGSQFMYVVDTRPKLNAMANRAAGKGYENEDNYANIRFRFMGIENIHVMR    211 - 280
SSLQKLLEVCELKTPTMSEFLSGLESSGWLRHIKAIMDAGIFITKAVKVEKASVLVHCSDGWDRTAQVCS    281 - 350
VASILLDPFYRTFKGLMILIEKEWISMGHKFSQRCGHLDGDSKEVSPIFTQFLDCIWQLMEQFPCAFEFN    351 - 420
ENFLLEIHDHVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTMYGVLNPSTVP    421 - 490
YNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKVRDEPPEEICTCSQLGNILSQ    491 - 560
HLGSPLTNPLGFMGINGDLNTLMENGTLSREGGLRAQMDQVKSQGADLHHNCCEIVGSLRAINISGDVGI    561 - 630
SEAMGISGDMCTFEATGFSKDLGICGAMDISEATGISGNLGISEARGFSGDMGILGDTGISKASTKEADY    631 - 700
SKHQ                                                                      701 - 704
//

Text Mined References (12)

PMID Year Title
26143924 2015 Structure of the catalytic phosphatase domain of MTMR8: implications for dimerization, membrane association and reversible oxidation.
24282552 2013 X-linked MTMR8 diversity and evolutionary history of sub-Saharan populations.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16787938 2006 Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11275328 2001 The myotubularin family: from genetic disease to phosphoinositide metabolism.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.