Property Summary

NCBI Gene PubMed Count 39
PubMed Score 10.28
PubTator Score 17.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.200 9.5e-03
oligodendroglioma 1.300 4.0e-03
psoriasis -1.200 7.2e-03
osteosarcoma -1.995 1.4e-06
astrocytoma 1.100 4.0e-03
group 4 medulloblastoma 1.500 4.4e-04
medulloblastoma, large-cell 1.100 1.4e-03
spina bifida -1.366 4.8e-02
acute myeloid leukemia 1.200 1.7e-02
ovarian cancer -1.200 3.3e-08

Gene RIF (14)

PMID Text
26787466 Data suggest MTMR3 has multiple functions in regulation of autophagy; one mechanism appears to be direct interaction between MTMR3 and mTORC1 (MTOR, mLST8, raptor) which inhibits phosphorylation activity of mTORC1; MTMR3 is localized to Golgi apparatus.
26240347 the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation
25659891 myotubularin-related protein 3 and myotubularin-related protein 4 may act as a bridge between CEP55 and polo-like kinase 1, ensuring proper CEP55 phosphorylation and regulating CEP55 recruitment to the midbody.
25215329 These results indicate that MTMR3 may play an important role in the progression of CRC and suggest that siRNA mediated silencing of MTMR3 could be an effective tool in CRC treatment.
25195900 cloning, expression, purification and crystallization of human myotubularin-related protein 3 encompassing the PH-GRAM and the phosphatase catalytic domain are reported
24943867 Our results suggest that the MTMR3 gene is shared between IgA nephropathy and lupus nephritis in the northern Chinese population, further highlighting the role of autophagy in systemic lupus erythematosus.
24840251 Data suggest MTMR3, PIKFYVE (phosphoinositide kinase FYVE), and their product phosphatidylinositol 5-phosphate are involved in activation of RAC1 (rho family small GTP binding protein); this process regulates migration/invasion of carcinoma/sarcoma.
23154468 Production of phosphatidylinositol 5-phosphate via PIKfyve and MTMR3 regulates cell migration.
20477815 Observational study of gene-disease association. (HuGE Navigator)
20059746 Autophagosome formation was triggered by the overexpression of a dominant-negative inactive mutant of Myotubularin-related phosphatase 3 (MTMR3).
18774718 A phylogenetic study revealing co-evolution of myotubularins with PI 3-kinase class III complex
15840652 analysis of MTMR3 phosphoinositide binding domain properties
11846405 MTMR3 shares similar phosphatase activity and substrate specificity with its homologous proteins MTM1 and MTMR3
9736772 MTMR3 belongs to the myotubularin family of phosphoinositides phosphatases

AA Sequence

MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRLHIKFKESLVN      1 - 70
VPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRPPAKIEDLFSFAYHAWCMEVY     71 - 140
ASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVS    141 - 210
SFRSWKRIPAVIYRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRD    211 - 280
FPNGGDLSDVEFDSSLSNASGAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMA    281 - 350
NIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRT    351 - 420
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWLDCVHQLQRQF    421 - 490
PCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVL    491 - 560
YPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASR    561 - 630
RCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEE    631 - 700
SGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQS    701 - 770
GLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQSCSLLPSQVPFETRGP    771 - 840
NVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVHRTSLGSTLSL    841 - 910
TRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCANGEAGRSKDSLSRQLSAMSCS    911 - 980
SAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGMSVYTDTIQQRLRQIESGHQQEVETLKKQVQ    981 - 1050
ELKSRLESQYLTSSLHFNGDFGDEVTSIPDSESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDH   1051 - 1120
LAAHCYACDSAFWLASRKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELD   1121 - 1190
KPIAATSN                                                                 1191 - 1198
//

Text Mined References (46)

PMID Year Title
26787466 2016 The PtdIns3-phosphatase MTMR3 interacts with mTORC1 and suppresses its activity.
26240347 2015 MTMR3 risk allele enhances innate receptor-induced signaling and cytokines by decreasing autophagy and increasing caspase-1 activation.
25659891 2015 Myotubularin-related proteins 3 and 4 interact with polo-like kinase 1 and centrosomal protein of 55 kDa to ensure proper abscission.
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25215329 2014 Myotubularin-related phosphatase 3 promotes growth of colorectal cancer cells.
25195900 2014 Expression, purification, crystallization and preliminary crystallographic analysis of human myotubularin-related protein 3.
24943867 2014 Brief Report: identification of MTMR3 as a novel susceptibility gene for lupus nephritis in northern Han Chinese by shared-gene analysis with IgA nephropathy.
24840251 2014 PIKfyve, MTMR3 and their product PtdIns5P regulate cancer cell migration and invasion through activation of Rac1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23154468 2013 Production of phosphatidylinositol 5-phosphate via PIKfyve and MTMR3 regulates cell migration.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22197929 2011 A genome-wide association study in Han Chinese identifies multiple susceptibility loci for IgA nephropathy.
21725308 2011 A genome-wide association study identifies two new lung cancer susceptibility loci at 13q12.12 and 22q12.2 in Han Chinese.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20477815 2010 Mutational analysis of mononucleotide repeats in dual specificity tyrosine phosphatase genes in gastric and colon carcinomas with microsatellite instability.
20059746 2010 Modulation of local PtdIns3P levels by the PI phosphatase MTMR3 regulates constitutive autophagy.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18774718 2008 PtdIns5P regulation through evolution: roles in membrane trafficking?
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16787938 2006 Systematic analysis of myotubularins: heteromeric interactions, subcellular localisation and endosome related functions.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15840652 2005 Analysis of phosphoinositide binding domain properties within the myotubularin-related protein MTMR3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11846405 2002 Functional redundancy in the myotubularin family.
11676921 2001 Characterization of MTMR3. an inositol lipid 3-phosphatase with novel substrate specificity.
11302699 2001 FYVE-DSP2, a FYVE domain-containing dual specificity protein phosphatase that dephosphorylates phosphotidylinositol 3-phosphate.
11181995 2001 The sequence of the human genome.
10900271 2000 Myotubularin, a protein tyrosine phosphatase mutated in myotubular myopathy, dephosphorylates the lipid second messenger, phosphatidylinositol 3-phosphate.
10733931 2000 FYVE-DSP1, a dual-specificity protein phosphatase containing an FYVE domain.
10591208 1999 The DNA sequence of human chromosome 22.
9847074 1998 Toward a complete human genome sequence.
9736772 1998 Characterization of the myotubularin dual specificity phosphatase gene family from yeast to human.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8640223 1996 A gene mutated in X-linked myotubular myopathy defines a new putative tyrosine phosphatase family conserved in yeast.