Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.81
PubTator Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -2.064 4.5e-06
intraductal papillary-mucinous neoplasm ... 1.100 3.2e-03
malignant mesothelioma 1.100 2.0e-05
osteosarcoma -1.312 1.3e-03
psoriasis -2.800 3.7e-05

Gene RIF (2)

AA Sequence

MEPRAVGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIKDLDVFARTQEVKVDPDKPL      1 - 70
EGVRLLVLQSKKTLLVPTPRLRTGLFNKITPPPGATKDILRKCATSQGVRNYSVPIGLDSRVLVDLVVVG     71 - 140
SVAVSEKGWRIGKGEGYADLEYAMMVSMGAVSKETPVVTIVHDCQVVDIPEELVEEHDITVDYILTPTRV    141 - 210
IATGCKRPKPMGITWFKISLEMMEKIPILRSLRAREQQAGKDVTLQGEHQHLPEPGCQQTVPLSVGRRPP    211 - 280
DTPGPETNSMEAAPGSPPGEGAPLAADVYVGNLPGDARVSDLKRALRELGSVPLRLTWQGPRRRAFLHYP    281 - 350
DSAAAQQAVSCLQGLRLGTDTLRVALARQQRDK                                         351 - 383
//

Text Mined References (8)

PMID Year Title