Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.32
PubTator Score 15.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (38)

Disease log2 FC p
malignant mesothelioma 1.500 7.7e-07
astrocytoma 3.300 1.7e-30
oligodendroglioma 3.100 3.9e-17
esophageal adenocarcinoma 1.300 2.9e-02
psoriasis 2.300 5.0e-05
glioblastoma 2.900 3.8e-04
osteosarcoma -4.095 7.1e-08
sonic hedgehog group medulloblastoma 2.400 5.2e-06
atypical teratoid/rhabdoid tumor 1.300 1.3e-03
medulloblastoma, large-cell 3.000 3.1e-07
primitive neuroectodermal tumor 1.200 9.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.012 1.8e-02
juvenile dermatomyositis 1.767 4.9e-11
Amyotrophic Lateral Sclerosis 1.622 3.8e-07
acute quadriplegic myopathy 2.583 1.1e-07
adrenocortical carcinoma 1.565 1.9e-04
pancreatic ductal adenocarcinoma liver m... 1.987 3.1e-02
non-small cell lung cancer 1.380 4.9e-17
lung cancer 2.600 3.0e-05
colon cancer 1.100 3.9e-05
active Crohn's disease 1.489 7.4e-03
ulcerative colitis 1.900 5.9e-09
breast carcinoma 1.400 4.8e-26
diabetes mellitus -1.200 8.0e-03
interstitial cystitis 2.000 7.7e-04
adult high grade glioma 2.000 2.5e-04
pilocytic astrocytoma 1.600 1.5e-04
lung adenocarcinoma 1.200 2.2e-06
nasopharyngeal carcinoma 1.400 2.2e-04
Breast cancer 1.600 8.9e-07
Polycystic Ovary Syndrome -1.258 1.2e-02
ductal carcinoma in situ 1.800 9.2e-05
invasive ductal carcinoma 1.900 2.0e-04
ovarian cancer 2.400 3.2e-03
pituitary cancer -2.300 8.3e-04
pancreatic cancer -1.800 1.6e-03
dermatomyositis 1.700 1.6e-02
head and neck cancer 1.200 5.3e-03

Protein-protein Interaction (6)

Gene RIF (16)

PMID Text
26461067 These findings suggest a previously unknown role for MTHFD2 in cancer cell proliferation, adding to its known function in mitochondrial folate metabolism.
24870594 Data indicate that methylenetetrahydrofolate dehydrogenase (NADP + -dependent) 2 (MTHFD2)was differentially expressed in breast cancer tissue, suggesting as a prognostic factor and a potential therapeutic target for future breast cancer treatments.
24451681 The highest scoring pathway is mitochondrial one-carbon metabolism and is centred on MTHFD2.
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
22190034 HIV-1 Nef is identified to have a physical interaction with methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 (MTHFD2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19493349 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAATSLMSALAARLLQPAHSCSLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHL      1 - 70
SVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHID     71 - 140
ERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIA    141 - 210
MLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVH    211 - 280
DPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREVLKSKELGVATN    281 - 350
//

Text Mined References (33)

PMID Year Title
26461067 2015 The folate-coupled enzyme MTHFD2 is a nuclear protein and promotes cell proliferation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24870594 2014 Increased MTHFD2 expression is associated with poor prognosis in breast cancer.
24451681 2014 Metabolic enzyme expression highlights a key role for MTHFD2 and the mitochondrial folate pathway in cancer.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342116 2004 The expression of mitochondrial methylenetetrahydrofolate dehydrogenase-cyclohydrolase supports a role in rapid cell growth.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9454603 1998 Methenyltetrahydrofolate cyclohydrolase is rate limiting for the enzymatic conversion of 10-formyltetrahydrofolate to 5,10-methylenetetrahydrofolate in bifunctional dehydrogenase-cyclohydrolase enzymes.
8939898 1996 Homocysteine-respondent genes in vascular endothelial cells identified by differential display analysis. GRP78/BiP and novel genes.
8218174 1993 NAD-dependent methylenetetrahydrofolate dehydrogenase-methenyltetrahydrofolate cyclohydrolase is the mammalian homolog of the mitochondrial enzyme encoded by the yeast MIS1 gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2587219 1989 Nucleotide sequence of the human NAD-dependent methylene tetrahydrofolate dehydrogenase-cyclohydrolase.