Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.85
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.0e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.361 4.0e-06

Gene RIF (2)

PMID Text
23396448 The results suggested that Mtg1 functions with the large subunit of the mitochondrial ribosome, and are involved in both the translation and assembly of respiratory complexes.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQ      1 - 70
ETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKE     71 - 140
NLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPR    141 - 210
IESVETGLKLALCGTVLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQ    211 - 280
KVKVLTGTGNVNIIQPNYPAAARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP                    281 - 334
//

Text Mined References (13)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
23396448 2013 Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342797 2004 Evolution of vertebrate genes related to prion and Shadoo proteins--clues from comparative genomic analysis.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527721 2003 Shadoo, a new protein highly conserved from fish to mammals and with similarity to prion protein.
12808030 2003 MTG1 codes for a conserved protein required for mitochondrial translation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.