Property Summary

NCBI Gene PubMed Count 8
PubMed Score 51.99
PubTator Score 50.34

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.95858612456288E-7
malignant mesothelioma 3163 3.168769246058E-7
medulloblastoma, large-cell 6234 2.65117725424643E-6
lung cancer 4473 3.09258394015204E-5
atypical teratoid / rhabdoid tumor 4369 1.03417279115829E-4
pediatric high grade glioma 2712 1.78372123169424E-4
ovarian cancer 8492 1.96385382996281E-4
primitive neuroectodermal tumor 3031 2.94481154944891E-4
psoriasis 6685 8.29670446450018E-4
osteosarcoma 7933 8.78446494138116E-4
invasive ductal carcinoma 2950 0.00168868545980406
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00426281420769798
Waldenstrons macroglobulinemia 765 0.00489120094798424
pancreatic cancer 2300 0.0127927369792983
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0170839150404161
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0172743709230474
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0180187080200552
Disease Target Count Z-score Confidence
Gonorrhea 14 3.1 1.6



Accession Q9Y483 A6NGQ9 A8K2Q3 B1AKT5 B1AKT6 Q9UES9 Q9UP40
Symbols M96


PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

25923537 the F61L/S86F mutant of MTF2 Tudor-PHD1 was able to bind to H3K36me3 as strong as the PHF1 Tudor bound to this PTM . We concluded that the hydrophobic patch plays an essential role in binding of these Tudors to methylated chromatin

AA Sequence

RIACGEKYRVLARRVTLDGKVQYLVEWEGATAS                                         561 - 593

Text Mined References (13)

PMID Year Title
25923537 2015 An aromatic cage is required but not sufficient for binding of Tudor domains of the Polycomblike protein family to H3K36me3.
23228662 2013 Tudor domains of the PRC2 components PHF1 and PHF19 selectively bind to histone H3K36me3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142980 2012 Molecular basis for H3K36me3 recognition by the Tudor domain of PHF1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15563832 2004 A novel human homologue of Drosophila polycomblike gene is up-regulated in multiple cancers.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.