Property Summary

NCBI Gene PubMed Count 40
PubMed Score 96.62
PubTator Score 104.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.127 3.6e-04
medulloblastoma, large-cell -1.300 1.5e-04
tuberculosis -1.200 1.8e-06
acute myeloid leukemia 1.400 2.2e-02
ovarian cancer 1.300 3.4e-03

Gene RIF (24)

PMID Text
26529669 Forty-one single nucleotide polymorphisms (SNPs) within the MTF1 gene region.
26336656 MTF-1 has a role in regulating zinc dependent cellular processes at the molecular level [review]
25618524 Human ZnT2 expression is regulated by MTF-1.
25162517 Zn-responsive proteome profiling and time-dependent expression of proteins are regulated by MTF-1 in human alveolar epithelial cells.
23368743 The zinc-sensing cytoplasmic transcription factor MTF-1 plays a key role in cellular zinc homoeostasis.
22057392 Results identify a cysteine cluster that mediates homodimerization of human MTF-1, and show that dimer formation in vivo is important for basal and especially metal-induced transcriptional activity.
22021037 It is concluded that SUMO conjugation and the SIM on MTF-1 do not play a critical role in suppressing transcriptional activity. Instead, MTF-1 forms complexes with cellular factors through SIM and SUMO moiety in the cytoplasm
21798283 Variations in the ability of LAT1/DMT1/MTF1/MT1a to process and transport Hg may not play a significant role in the etiology of autism.
21386983 Transcriptional regulation of the beta-synuclein 5'-promoter metal response element by metal transcription factor-1.
20688958 Zinc and cadmium can activate FPN1 transcription through the MTF-1.
20026331 Data show that hepcidin transcription involves interactions between functional metal response elements (MREs) in its promoter, and the MRE-binding transcription factor-1.
19956853 Loss of LI-cadherin results in up-regulation of MTF-1 and PlGF, thereby regulating angiogenesis in intrahepatic cholangiocarcinoma
19913599 Genetic regulation via sequences downstream of promoters highlights a new direction for identifying previously unrecognized target genes for MTF-1.
19797083 show that the acidic activation domain of hMTF-1 can work as a zinc-inducible activation domain independent of the full-length protein context.
19286843 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19022893 Findings suggest that MTF-1 is involved in hypoxia-dependent regulation of PlGF in trophoblast-derived cells.
18990686 SP1 and MTF-1 represent new targets in the development of key therapeutics toward modulating the expression of the cellular prion protein and ultimately the prevention of prion disease
17503480 Observational study of gene-disease association. (HuGE Navigator)
15318808 The MTF-1 serves targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration and under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene PIGF.
14610091 MTF-1 contains a cysteine-rich cluster, -632Cys-Gln-Cys-Gln-Cys-Ala-Cys638-, which appears to be specifically required for MTF-1 to activate transcription in the presence of inducing heavy metal ions.
12805380 mediates transcriptional hyperactivation along with heat and heavy metal stress
12716893 MTF1 transactivation potential is affected by chromium levels
11923282 role in regulating metallothionein transcription

AA Sequence

MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEH      1 - 70
LPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY     71 - 140
QCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAFLTSYSLRIHVRVHTKEKPFECDVQGCEKA    141 - 210
FNTLYRLKAHQRLHTGKTFNCESEGCSKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHV    211 - 280
RTHTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSEL    281 - 350
RENSSTTQGQDLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP    351 - 420
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQEFLPHPQ    421 - 490
APQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGANSVLTNNPTITITPTPNTAI    491 - 560
LQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPGSSVQQIGLSVPVIIIKQEE    561 - 630
ACQCQCACRDSAKERASSRRKGCSSPPPPEPSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQ    631 - 700
AETPSDPQTETLSAMDVSEFLSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK                     701 - 753
//

Text Mined References (41)

PMID Year Title
26529669 2015 Genetic variation in metallothionein and metal-regulatory transcription factor 1 in relation to urinary cadmium, copper, and zinc.
26336656 2015 Metal responsive transcription factor 1 (MTF-1) regulates zinc dependent cellular processes at the molecular level.
25618524 2015 Coordinative modulation of human zinc transporter 2 gene expression through active and suppressive regulators.
25162517 2014 Zn-responsive proteome profiling and time-dependent expression of proteins regulated by MTF-1 in A549 cells.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23368743 2013 Zinc-dependent lysosomal enlargement in TRPML1-deficient cells involves MTF-1 transcription factor and ZnT4 (Slc30a4) transporter.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22057392 2012 A conserved cysteine cluster, essential for transcriptional activity, mediates homodimerization of human metal-responsive transcription factor-1 (MTF-1).
22021037 2011 The role of small ubiquitin-like modifier-interacting motif in the assembly and regulation of metal-responsive transcription factor 1.
21798283 2011 Lack of association between autism and four heavy metal regulatory genes.
21386983 2011 Transcriptional regulation of the beta-synuclein 5'-promoter metal response element by metal transcription factor-1.
20688958 2010 Induction of FPN1 transcription by MTF-1 reveals a role for ferroportin in transition metal efflux.
20026331 2010 Divalent metal-dependent regulation of hepcidin expression by MTF-1.
19956853 2010 Loss of liver-intestine cadherin in human intrahepatic cholangiocarcinoma promotes angiogenesis by up-regulating metal-responsive transcription factor-1 and placental growth factor.
19913599 2010 Metal transcription factor-1 regulation via MREs in the transcribed regions of selenoprotein H and other metal-responsive genes.
19797083 2009 Metal-responsive transcription factor 1 (MTF-1) activity is regulated by a nonconventional nuclear localization signal and a metal-responsive transactivation domain.
19286843 2009 Polymorphisms of DNA damage response genes in radiation-related and sporadic papillary thyroid carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19022893 2009 Metal transcription factor-1 is involved in hypoxia-dependent regulation of placenta growth factor in trophoblast-derived cells.
18990686 2009 Regulation of prion gene expression by transcription factors SP1 and metal transcription factor-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17503480 2007 Genetic susceptibility to environmental toxicants in ALS.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15735762 2005 Induction of human metallothionein 1G promoter by VEGF and heavy metals: differential involvement of E2F and metal transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15318808 2004 Metal-responsive transcription factor (MTF-1) and heavy metal stress response in Drosophila and mammalian cells: a functional comparison.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14610091 2004 A novel cysteine cluster in human metal-responsive transcription factor 1 is required for heavy metal-induced transcriptional activation in vivo.
12805380 2003 Heat and heavy metal stress synergize to mediate transcriptional hyperactivation by metal-responsive transcription factor MTF-1.
12716893 2003 Chromium(VI) down-regulates heavy metal-induced metallothionein gene transcription by modifying transactivation potential of the key transcription factor, metal-responsive transcription factor 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306562 2001 Nucleo-cytoplasmic trafficking of metal-regulatory transcription factor 1 is regulated by diverse stress signals.
11004505 2000 Novel responses of ZRF, a variant of human MTF-1, to in vivo treatment with heavy metals.
10504263 1999 MRE-Binding transcription factor-1: weak zinc-binding finger domains 5 and 6 modulate the structure, affinity, and specificity of the metal-response element complex.
9582278 1998 Embryonic lethality and liver degeneration in mice lacking the metal-responsive transcriptional activator MTF-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8065932 1994 Cloning, chromosomal mapping and characterization of the human metal-regulatory transcription factor MTF-1.