Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.22
PubTator Score 5.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 2.3e-06
ovarian cancer 8520 5.0e-04
lung cancer 4740 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.500 1.4e-02
nasopharyngeal carcinoma 1.300 2.3e-06
ovarian cancer 1.800 5.0e-04

Gene RIF (2)

AA Sequence

MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKTYRTSSLWNSS      1 - 70
QSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLP     71 - 140
PASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLT    141 - 210
KNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLV    211 - 280
VRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVK    281 - 350
FPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL       351 - 417
//

Text Mined References (16)

PMID Year Title