Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.22
PubTator Score 5.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 2.3e-06
lung cancer 4473 3.1e-05
ovarian cancer 8491 5.0e-04

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 2.000 3.1e-05
nasopharyngeal carcinoma 1.300 2.3e-06
ovarian cancer 1.800 5.0e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20577816 MTERFD1 and MTERFD3 have a role in impairing the completion of mitochondrial DNA replication

AA Sequence

MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKTYRTSSLWNSS      1 - 70
QSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLP     71 - 140
PASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLT    141 - 210
KNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLV    211 - 280
VRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVK    281 - 350
FPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL       351 - 417
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20577816 2011 Overexpression of MTERFD1 or MTERFD3 impairs the completion of mitochondrial DNA replication.
20430012 2010 Structure of mitochondrial transcription termination factor 3 reveals a novel nucleic acid-binding domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17662942 2007 MTERF3 is a negative regulator of mammalian mtDNA transcription.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16193327 2005 A family of putative transcription termination factors shared amongst metazoans and plants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.