Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.58
PubTator Score 6.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 2.6e-07
Pick disease 1856 2.3e-04
osteosarcoma 7766 7.7e-04
group 3 medulloblastoma 4002 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.4e-02
osteosarcoma -1.493 7.7e-04
ovarian cancer -1.300 2.6e-07
Pick disease -1.300 2.3e-04

Gene RIF (5)

AA Sequence

MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIRKIRRLKGWVL      1 - 70
LEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESF     71 - 140
FTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLL    141 - 210
KLLSQNPFILLNSPTAIKETLEFLQEQGFTSFEILQLLSKLKGFLFQLCPRSIQNSISFSKNAFKCTDHD    211 - 280
LKQLVLKCPALLYYSVPVLEERMQGLLREGISIAQIRETPMVLELTPQIVQYRIRKLNSSGYRIKDGHLA    281 - 350
NLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE                                       351 - 385
//

Text Mined References (15)

PMID Year Title