Property Summary

NCBI Gene PubMed Count 177
PubMed Score 379.15
PubTator Score 240.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.525 1.5e-02
esophageal adenocarcinoma 1.300 2.6e-02
psoriasis 1.700 3.9e-05
osteosarcoma 2.897 1.8e-05
glioblastoma 1.200 1.2e-02
medulloblastoma, large-cell 1.300 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.178 1.9e-02
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
Breast cancer 3.400 3.0e-02
pediatric high grade glioma 1.200 1.0e-04
group 3 medulloblastoma 1.100 2.3e-02
primary Sjogren syndrome 1.200 1.0e-02
ulcerative colitis 1.300 2.1e-07
ovarian cancer 2.800 2.4e-05
Down syndrome 1.200 1.3e-03
dermatomyositis 1.100 1.8e-02

Protein-protein Interaction (2)

Gene RIF (174)

PMID Text
26884832 MiR-30a-5p may play an essential role in the cell growth and apoptosis of hepatocellular carcinoma cells, partially via targeting AEG-1.
26823698 Suggest that miR-377 plays an important role in the development of NSCLC by regulating AEG-1 expression.
26710214 High AEG-1 staining index might be associated with tumor progression and poor survival status in patients with gastrointestinal cancer. Meta-analysis.
26683226 High MTDH expression is associated with multiple myeloma.
26418251 Data showed that AEG1 and MMP7 levels were both significantly increased and strongly correlated in non-small cell lung cancer (NSCLC) tissues. AEG-1 promotes NSCLC cell invasiveness through MAPK-p42/p44-dependent activation of MMP7.
26362536 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
26351209 Identify two novel factors, AKR1C2 (positive factor) and NF1 (negative factor), as the AEG-1 downstream players in the process of metastasis in liver cancer.
26336827 Results indicate that microRNA miR-497 directly inhibited the 3'-untranslated regions (3' UTRs) of vascular endothelial growth factor A (VEGFA) and astrocyte elevated gene-1 (AEG-1).
26318406 We identified two powerful genes in the liver cancer metastasis process, AEG-1 and AKR1C2.
26287185 Knockdown of MTDH inhibits phosphorylation of AKT and increased apoptosis related protein expression.
26236947 Data suggest that activation of AMPK (AMP-activated protein kinase) in triple negative breast cancer cells down-regulates expression of MTDH (metadherin) via up-regulation of GSK3B (glycogen synthase kinase 3 beta) and SIRT1 (sirtuin 1) activities.
26176806 miR-302c-3p play a pivotal role in the progression of glioma by targeting MTDH and is a potential inhibitor in glioma treatment.
26156805 AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer.
26156800 AEG-1 regulates IGF-1-induced proliferation and apoptosis via Erk1/2 and Akt signaling in CM development, which suggests IGF-1-AEG-1 signaling could
26141861 our work revealed that MTDH promotes CSC accumulation and breast tumorigenicity by regulating TWIST1, deepening the understanding of MTDH function in cancer.
26134542 AEG-1 mediates CCL3/CCR5-induced EMT development via both Erk1/2 and Akt signaling pathway in CM patients, which indicates CCL3/CCR5-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of CM.
26122237 mRNA and protein expression level of metadherin in breast cancer cells both improved after transfection. The inhibition effect of 1 mg/L doxorubicin and 8 mg/L taxol on breast cancer cells decreased after metadherin transfection.
26051629 MTDH might be used as a potential therapeutic target in the lymph node metastasis of ESCC
26035424 Data established that AEG-1 is frequently upregulated and functions as an oncogene by regulating several major signaling pathways in hepatocellular carcinoma (HCC) suggesting potential role as a biomarker or target for HCC therapy. [review]
26016795 ectopic miR-217 expression decreased AEG-1 expression and repressed luciferase reporter activity associated with the AEG-1 3'-untranslated region (UTR).
25987128 EFEMP1 might indirectly enhance the expression of MMP-2, providing a potential explanation for the role of AEG-1 in metastasis. NF-kappaB pathways might be one of the effective ways which EFEMP1 was induced by AEG-1.
25944909 AEG-1 thus might play a role in NTIS associated with HCC and other cancers.
25913216 In patients with non-small cell lung cancer, AEG-1 expression was an independent prognostic factor for both overall and disease-free survival.
25902416 Study provides evidence that the knockdown of MTDH signi fi cantly inhibited angiogenesis suggesting that MTDH is a potential therapeutic target for anti-angiogenesis in breast cancer.
25880337 These results reveal the critical role of AEG-1 in EMT and suggest that AEG-1 may be a prognostic biomarker and its targeted inhibition may be utilized as a novel therapy for NSCLC.
25824750 Overexpression of astrocyte elevated gene-1 is associated with angiogenesis in cervical cancer.
25794773 Results indicated that MTDH was a direct downstream target of miR-153 and was involved in the miR-153-induced suppression of the migration and invasion in breast cancer cell.
25787750 Real-time quantitative RT-PCR revealed a dose-dependent decrease in RNA-binding factor 1 (AUF-1) and astrocyte elevated gene-1 (AEG-1) messenger RNA (mRNA) levels in TP-1-treated SMMC-7721 cells
25695541 AEG-1 was associated with the progression of cervical squamous cell carcinoma by promoting epithelial-mesenchymal transition via Wnt signaling pathway.
25684730 Repression of metadherin inhibits biological behavior of prostate cancer cells and enhances their sensitivity to cisplatin.
25652471 our results suggest that the evodiamine suppress the proliferation of lung cancer cells, at least, in part, via inhibition of MTDH expression and activation of apoptosis.
25631074 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
25575438 The results demonstrate that MTDH is specifically expressed in B cell of chronic lymphocytic leukemia and exert a preservative role through activation of Wnt signaling pathway
25484183 A competitive endogenous RNAs regulatory network among AEG-1, Snail and Vimentin mediated via competitive binding to miR-30a was proved.
25483832 AEG1 is a valuable biomarker for the prediction of ovarian cancer prognosis, and AEG1 inhibition may be a potential therapeutic strategy for ovarian cancer treatment.
25432696 data suggest that miR-542-3p might function as a tumor suppressor in gastric cancer, potentially by targeting the oncogene AEG-1
25431427 Data suggest that AEG-1 plays an important role in renal cancer formation and development.
25428378 we have reported the altered expression of miR-145 in NSCLC cell lines and that miR-145 could modulate cell proliferation and invasion by targeting AEG-1/MTDH
25417825 MTDH mediates trastuzumab resistance, at least in part, by PTEN inhibition through an NFkappaB-dependent pathway, which may be utilized as a promising therapeutic target for HER2 positive breast cancer.
25407490 AEG-1 may be a novel predictor for metastasis and prognosis of the patients with GC.
25346496 Data provide evidence that MTDH has a functional role in the progression and metastatic spread of ovarian cancer.
25333261 MTDH up-regulation was associated with high-grade serous ovarian carcinoma.
25323629 microRNA-22 acts as a metastasis suppressor by targeting metadherin in gastric cancer.
25304263 Our study uncovers a novel molecular mechanism by which AEG-1 augments glioma progression and offers a rationale to block AEG-1-Akt2 signaling function as a novel GBM treatment.
25204501 Taken together, our findings suggest that AEG-1 plays a crucial role in the aggressiveness of osteosarcoma via the JNK/c-Jun/MMP-2 pathway.
25197376 our data suggest that AEG-1 may represent a novel prognostic marker for astrocytomas.
25193383 our findings offer in vivo proofs that AEG-1 is essential for NF-kappaB activation and hepatocarcinogenesis, and they reveal new roles for AEG-1 in shaping the tumor microenvironment for HCC development
25182604 Results demonstrate an increased expression of AEG-1 in malignant meningiomas correlated with grade; elevation of AEG-1 promotes malignant tumor progression in meningioma by an increase in cell proliferation, tumorigenicity, and a decrease in apoptosis
25174891 MTDH mediated metastasis of Osteosarcoma through regulating epithelial-mesenchymal transition.
25125681 Study establishes AEG-1 as a novel homeostatic regulator of RXR and RXR/RAR that might contribute to hepatocarcinogenesis.
25092897 results demonstrate that AEG-1 can promote gastric cancer progression by a positive feedback TLR4/NF-kappaB signaling-related mechanism
25074613 Findings establish a pivotal role for MTDH in prostate cancer progression and metastasis.
25050974 HBx could elevate AEG-1 protein level without altering its mRNA level. When blocking AEG-1 expression with siRNA in HBx-transfected cells, the HBx-induced cell migration was significantly suppressed.
25010285 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
24989027 Study suggests that AEG-1 protein was highly expressed in pancreatic ductal adenocarcinoma and associated with poor prognosis of the patients.
24981741 MTDH supports the survival of mammary epithelial cells under oncogenic/stress conditions by interacting with and stabilizing SND1.
24963474 Strong p50, p65, and metadherin expression was associated with a high probability to distinguish ovarian carcinomas over borderline and benign ovarian tumours
24946951 Determination of MTDH expression in primary CRC may be useful in the earlier detection of lung metastases in patients with high expression and increased risk
24941119 AEG-1 promotes anoikis resistance and orientation chemotaxis in hepatocellular carcinoma cells.
24855648 IL-1beta- or TNF-alpha-induced AEG-1 interaction with NF-kappaB p65 subunit.
24855648 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
24829520 Astrocyte elevated gene-1 mediates glycolysis and tumorigenesis in colorectal carcinoma cells via AMPK signaling
24829140 AEG-1 was overexpressed in bladder cancer tissues, compared with normal tissues.AEG-1 is associated with tumor progression in nonmuscle-invasive bladder cancer.
24817955 Metadherin contribute to BCR signaling in chronic lymphocytic leukemia.
24705862 AEG-1 appears to be a novel therapeutic target for preventing the metastasis of CRC.
24675891 Knockdown of astrocyte elevated gene-1 (AEG-1) in cervical cancer cells decreases their invasiveness, epithelial to mesenchymal transition, and chemoresistance.
24674449 An association between MTDH rs1835740 SNP and migraine in a Swedish case-control study.
24659263 AEG-1 promoter variant -483 A>C may be associated with the susceptibility to HCC in Iranian population
24656097 Expression of AEG-1 may be correlated with tumor angiogenesis and metastasis and is a valuable prognostic factor in patients with oral squamous cell carcinoma
24529480 Specific sites of LYRIC/AEG-1 ubiquitination are essential for regulating LYRIC/AEG-1 localisation and functionally interacting proteins.
24495449 MTDH/AEG-1 overexpression contributes to the neoplastic phenotype of bladder cancer cells by promoting survival, clonogenicity, and migration
24462870 Targeted inhibition of AEG-1 can lead to modification of key elemental characteristics, such as miRNAs, which may become a potential effective therapeutic strategy for CRC
24256614 High expression of astrocyte elevated gene-1 is associated with progression of cervical intraepithelial neoplasia.
24136747 These findings suggest that AEG-1 may be an epithelial-mesenchymal transition-associated biomarker in human hepatocellular carcinoma and play important roles in the progression of hepatocellular carcinoma
24119914 AEG-1 gene expression associated with poor prognosis in children with Wilms tumor.
24063540 AEG-1 increases phosphorylation of the p65 subunit of NF-kappaB, and regulates the expression of MMP1 in head and neck squamous cell carcinoma cells.
23910058 LY294002 treatment down-regulated AEG-1 expression in hepatocellular carcinoma
23889992 Combination of AEG-1 inhibition and chemotherapy has documented significant efficacy in abrogating human hepatocellular carcinoma(HCC) xenografts.[review]
23889991 As an oncogene that promotes aberrant cellular processes within the CNS, AEG-1/MTDH/LYRIC represents an important therapeutic target for the treatment of neurological disease. [review]
23889990 The multiple functions of AEG-1/MTDH/LYRIC in drug resistance highlight that it is a viable target as an anticancer agent for a wide variety of cancers. [review]
23889989 Discovery of agents that can block AEG-1 and its regulated pathways will be beneficial to cancer patients with aberrant expression of AEG-1.[review]
23889988 AEG-1 function relative to signaling changes, interacting partners, and angiogenesis and new perspectives on its potential as a significant target for the clinical treatment of cancers and other diseases. [review]
23889987 A comprehensive analysis of the existing literature to emphasize the common and conflicting findings relative to the clinical significance of AEG-1/MTDH/LYRIC in cancer. [Review]
23889986 Initial cloning, structure, expression profile, and regulation of expression of AEG-1 protein. [Review]
23874603 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
23851509 High metadherin is associated with breast tumor growth and metastasis.
23835593 Overexpression of astrocyte-elevated gene-1 is associated with cervical carcinoma progression and angiogenesis.
23710918 AEG-1 protein might play a critical role in the initiation and progression of laryngeal squamous cell carcinoma
23640911 AEG-1 plays an important role in TGF-beta1-induced epithelial-mesenchymal transition through activation of p38 MAPK in proximal tubular epithelial cells.
23595222 MTDH expression is high in cervical cancer, and it contributes to chemoresistance of cervical cancer.
23499911 AEG-1 could potentially serve as an alternative target to AURKA for drug design and therapeutic treatment, to achieve more specific killing of AML cells while sparing normal cells.
23408429 oncogene metadherin modulates the apoptotic pathway based on the tumor necrosis factor superfamily member TRAIL (Tumor Necrosis Factor-related Apoptosis-inducing Ligand) in breast cancer
23364922 MTDH overexpression was tightly associated with more aggressive tumour behaviour and a poor prognosis, indicating that MTDH is a valuable molecular biomarker for laryngeal squamous cell carcinoma progression.
23307243 our results indicated that AEG-1 played a crucial role in the carcinogenesis of non-small cell lung cancer
23240043 These data suggest that MTDH (-470G>A) could be a useful molecular marker for assessing ovarian cancer risk and for predicting ovarian cancer patient prognosis.
23142337 High AEG-1 expression was associated with tongue carcinoma.
23065261 The increased expression of MTDH and/or SND1 is closely related to carcinogenesis, progression, and prognosis of colon cancer.
23023948 findings demonstrate that AEG-1 plays a crucial role in T-cell non-Hodgkin's lymphoma growth and metastasis
23011158 Evidence that elevated expression of AEG-1 protein is correlated with poor prognosis and reduced survival of patients with neuroblastoma (P= 0.031).
22967897 miR-136 might play a tumor-suppressive role in human glioma
22938468 results demonstrated that expression of MTDH at the transcriptional level may be increased in gastric cancer tissue samples but with considerable heterogeneity
22903204 MTDH overexpression contributes to an aggressive phenotype, thus leading to a poor prognosis for primary invasive breast cancer.
22898150 MTDH protein may be a valuable marker of bladder cancer progression. MTDH expression is associated with poor overall survival in patients with bladder cancer.
22768080 MTDH contributes to the pathogenesis of diffuse large-B-cell lymphoma mediated by activation of Wnt/beta-catenin pathway
22689379 AEG-1 provides strong protection from senescence, AEG-1 induces marked up-regulation of FXII protein, and is associated with induction of steatosis.
22684557 These results suggested that the expression of MTDH/AEG-1 gene in HCC cell lines of different metastatic potentials was closely positively related to the abilities of orientation chemotaxis and adhesion of HCC cells.
22643064 AEG-1 is up-regulated, at the mRNA and the protein level, during colorectal cancer development and aggressiveness.
22470125 study detected MTDH expression in normal liver, chronic hepatitis B and HBV-related hepatocellular carcinoma(HCC)tissues; data showed that MTDH expression levels were elevated in the hepatitis B tissues and especially in the HBV-related HCC tissues compared to normal liver tissues
22431469 AEG-1 interacted with beta-catenin in CRC cells and AEG-1 expression was closely associated with progression of CRC. AEG-1 might be a potential therapeutic target in CRC.
22372608 Tumour AEG-1 overexpression is associated with poor prognosis and cisplatin resistance in advanced serous ovarian cancer.
22367022 MTDH affects the radiosensitivity of cervical cancer cells and that MTDH may be a novel target to improve cervical cancer radiation response.
22363329 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
22351252 AEG-1 was highly expressed in colorectal cancer and may be a potential biomarker for liver metastatic tumors.
22340175 AEG-1 might facilitate the proliferation and invasion of breast cancer cells by upregulating HER2/neu expression.
22246354 Overexpression of EphA7 and/or MTDH might indicate poor prognosis in squamous cell cancer of the tongue.
22204714 astrocyte-elevated gene-1 plays a crucial role in the carcinogenesis and aggressiveness of non-small cell lung cancer, promoting its metastasis by modulating matrix metalloproteinase-9 expression and leading to a poor clinical prognosis.
22199357 implicate cytoplasmic MTDH in cell survival and broad drug resistance via association with RNA and RNA-binding proteins.
22195048 MTDH is involved in inflammation-induced tumor progression.
22133054 AEG-1 expression is associated with salivary gland carcinomas progression.
22056881 miR-375 targets AEG-1 in HCC and suppresses liver cancer cell growth in vitro and in vivo
22031094 Data show that MiR-375 expression was significantly reduced, and conversely, metadherin (MTDH) was significantly increased in nasopharyngeal carcinoma (NPC) samples.
21976539 MTDH may promote hepatocellular carcinoma metastasis through the induction of epithelial-mesenchymal transition process
21964981 MTDH and EphA7 are markers for metastasis and poor prognosis of gallbladder adenocarcinoma.
21957284 Gag interacts with endogenous Lyric via its matrix (MA) and nucleocapsid (NC) domains.
21957284 Via Affinity purifications, MTDH (aka Lyric) interacts with HIV-1 Gag, is incorporated in virions and cleaved by HIV PR. Lyric interaction is conserved for retroviral Gag proteins. Cotransfections suggest a role for Lyric in regulating HIV infectivity.
21957284 HIV-1 Gag interacts with endogenous MTDH (Lyric/Aeg-1) via its matrix (MA) and nucleocapsid (NC) domains. Lyric is incorporated into HIV-1 virions and is cleaved by the HIV protease. Lyric influences HIV protein expression and infectivity.
21957284 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
21852380 AEG-1 contributes to glioma-induced neurodegeneration (a hallmark of this fatal tumo) through regulation of EAAT2 expression.
21753766 Data show that AEG-1/MTDH was directly regulated by miR-375.
21750868 Our results suggest that the AEG-1 protein is a valuable marker of GBC progression and could be a potential therapeutic target.
21750404 AEG-1 plays a crucial role in osteosarcoma progression through MMP-2, and AEG-1 could be a useful biomarker for the prediction of osteosarcoma progression and prognosis
21609571 The expression of EphA7 and/or MTDH might be closely related to the carcinogenesis, progression, clinical biological behaviors and prognosis of gallbladder adenocarcinoma.
21543927 AEG-1 is overexpressed in a great portion of epithelial ovarian cancer (EOC) patients with peritoneal dissemination and/or lymph node metastasis and may be clinically useful for predicting metastasis in EOC.
21495225 AEG-1 overexpression is associated with carcinogenesis and tumor progression in endometrial cancer.
21478147 SND1 as a novel MTDH-interacting protein and shown that it is a functionally and clinically significant mediator of metastasis.
21448238 Study revealed a modest gene-based significant association between migraine and the metadherin (MTDH) gene, previously identified in the first clinic-based GWA study (GWAS) for migraine (Bonferroni-corrected gene-based P-value=0.026).
21412050 Astrocyte elevated gene-1 activates AMPK in response to cellular metabolic stress and promotes protective autophagy.
21408129 All variants of the MTDH gene were investigated and the association of the variants with breast cancer development, was explored.
21371176 results suggest that MTDH could promote epithelial-mesenchymal transition in breast cancer cells in driving the progression of their aggressive behavior
21293286 high AEG-1 expression was associated with progression and prognosis of ovarian carcinoma.
21259255 AEG-1 expression may be related with tumor angiogenesis and progression and is a valuable prognostic factor in patients with triple-negative breast cancer.
21256156 historical perspective of AEG-1; evaluation of AEG-1 as a novel diagnostic/prognostic biomarker for a variety of cancers; understanding of the molecular and biochemical bases of oncogenic properties of AEG-1 [review]
21150314 Overexpression of AEG-1 increases cell migration and invasion of glioma cells.
21127263 AEG-1-mediated chemoresistance is because of protective autophagy and inhibition of AEG-1 results in a decrease in protective autophagy and chemosensitization of cancer cells.
21084864 Observations link AEG-1 overexpression in glioblastoma with hypoxia and glucose deprivation.
20952513 miR-26a functionally antagonizes human breast carcinogenesis by targeting MTDH and EZH2.
20845990 AEG-1 protein is overexpressed in RCC and plays an important role in tumor differentiation and progression.
20802479 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20625905 AEG-1 expression in colorectal carcinoma may be associated with tumor progression, and high AEG-1 expression correlates with poor overall survival
20565850 MTDH overexpression could be identified in proliferative breast lesions and may contribute to breast cancer progression.
20388796 although AEG-1 does not affect MDR1 gene transcription, it facilitates association of MDR1 mRNA to polysomes, resulting in increased translation
20388776 Findings show that AEG-1 contributes to glioma progression by enhancing MMP-9 transcription and tumor cell invasiveness, and underscore the importance of AEG-1 in glioma development and progression.
20300973 AEG-1 may play a role in Wnt/beta-catenin-mediated cancer progression
20236756 AEG-1 gene is clinically significant in human oligodendroglioma.
20053777 AEG-1 may play a crucial role in the pathogenesis of glioma.
19940250 findings demonstrate that aberrant AEG-1 expression plays a dominant positive role in regulating oncogenic transformation and angiogenesis
19740331 AEG-1 was suggested to be a LPS-responsive gene and involved in LPS-induced inflammatory response.
19648967 one mechanism for cells with altered LYRIC/AEG-1 expression to evade apoptosis and increase cell growth during tumourigenesis through the regulation of PLZF repression
19633686 Studies were further confirmed in clinical primary breast cancer specimens, in which high-level expression of AEG-1 was inversely correlated with the expression of FOXO1.
19448665 AEG-1 may play a crucial role in the pathogenesis of neuroblastoma and could represent a potential target for therapeutic intervention.
19383828 Increased cytoplasmic distribution of LYRIC is associated with prostate cancer.
19304953 Upregulation of AEG-1 plays an important role in the development and pathogenesis of human esophageal squamous cell carcinoma progression and pathogenesis.
19221438 AEG1 plays a central role in regulating diverse aspects of hepatocellular carcinoma pathogenesis and inhibition may lead to an effective therapeutic strategy for this disease.
19111877 establish MTDH as an important therapeutic target for simultaneously enhancing chemotherapy efficacy and reducing metastasis risk
18519759 AEG-1 protein is a valuable marker of breast cancer progression.
18440304 LYRIC/AEG-1 is a negative regulator of BCCIPalpha, promoting proteasomal degradation either through direct interaction, or potentially through an indirect mechanism involving downstream effects of the NF-kappaB signaling pathway.
18316612 AEG-1 might function as a coactivator for NF-kappaB, consequently augmenting expression of genes necessary for invasion of glioma cells
17704808 AEG-1 is an oncogene cooperating with Ha-ras as well as functioning as a downstream target gene of Ha-ras; may perform a central role in Ha-ras-mediated carcinogenesis.
17563745 AEG-1 is overexpressed in clinical prostate cancer (PC) tissue samples and cultured PC cells compared to benign prostatic hyperplasia tissue samples and normal prostate epithelial cells.
17397930 findings indicate that AEG-1 might play a pivotal role in the pathogenesis, progression and metastasis of diverse cancers
15927426 HIV-1 Gag interacts with MTDH as demonstrated by proximity dependent biotinylation proteomics
15383321 a novel protein LYRIC is recruited during the maturation of the tight junction complex.
15093543 overexpression of metadherin is associated with metastatic breast cancer
14980505 3D3/lyric is localized to the membrane of the endoplasmic reticulum, nuclear envelope, and the nucleolus.

AA Sequence

MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYG      1 - 70
WAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEA     71 - 140
VRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKV    141 - 210
LTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLT    211 - 280
VNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIG    281 - 350
STAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP    351 - 420
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSL    421 - 490
KTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQT    491 - 560
KSETSWESPKQIKKKKKARRET                                                    561 - 582
//

Text Mined References (187)

PMID Year Title
26884832 2015 MiR-30a-5p suppresses cell growth and enhances apoptosis of hepatocellular carcinoma cells via targeting AEG-1.
26823698 2015 MicroRNA-377 inhibits non-small-cell lung cancer through targeting AEG-1.
26710214 2015 Astrocyte Elevated Gene-1 as a Novel Clinicopathological and Prognostic Biomarker for Gastrointestinal Cancers: A Meta-Analysis with 2999 Patients.
26683226 2016 MTDH is an oncogene in multiple myeloma, which is suppressed by Bortezomib treatment.
26418251 2015 Astrocyte elevated gene-1 increases invasiveness of NSCLC through up-regulating MMP7.
26351209 2014 AEG-1 Promotes Metastasis Through Downstream AKR1C2 and NF1 in Liver Cancer.
26336827 2015 MiR-497 suppresses angiogenesis and metastasis of hepatocellular carcinoma by inhibiting VEGFA and AEG-1.
26318406 2016 High-Content Functional Screening of AEG-1 and AKR1C2 for the Promotion of Metastasis in Liver Cancer.
26287185 2015 Lentiviral-Mediated Short Hairpin RNA Knockdown of MTDH Inhibits Cell Growth and Induces Apoptosis by Regulating the PTEN/AKT Pathway in Hepatocellular Carcinoma.
26236947 2015 AMPK inhibits MTDH expression via GSK3? and SIRT1 activation: potential role in triple negative breast cancer cell proliferation.
26176806 2015 MiR-302c-3p suppresses invasion and proliferation of glioma cells via down-regulating metadherin (MTDH) expression.
26156805 2015 The key role of astrocyte elevated gene-1 in CCR6-induced EMT in cervical cancer.
26156800 2015 Astrocyte-elevated gene-1 mediates insulin-like growth factor 1-induced the progression of cardiac myxoma.
26141861 2015 Epigenetic Activation of TWIST1 by MTDH Promotes Cancer Stem-like Cell Traits in Breast Cancer.
26134542 2015 Astrocyte elevated gene-1 regulates CCL3/CCR5-induced epithelial-to-mesenchymal transition via Erk1/2 and Akt signaling in cardiac myxoma.
26122237 PROTEIN EXPRESSION OF METADHERIN AND SENSIBILITY OF BREAST CANCER MDA-MB-231 CELLS TO TREATMENT BEFORE AND AFTER TRANSFECTION.
26051629 2015 Metadherin is required for the proliferation, migration, and invasion of esophageal squamous cell carcinoma and its meta-analysis.
26035424 2015 The emerging role of astrocyte-elevated gene-1 in hepatocellular carcinoma (Review).
26016795 2015 MicroRNA-217 functions as a prognosis predictor and inhibits colorectal cancer cell proliferation and invasion via an AEG-1 dependent mechanism.
25987128 2015 EFEMP1 promotes the migration and invasion of osteosarcoma via MMP-2 with induction by AEG-1 via NF-?B signaling pathway.
25944909 2015 Astrocyte Elevated Gene-1 (AEG-1) Contributes to Non-thyroidal Illness Syndrome (NTIS) Associated with Hepatocellular Carcinoma (HCC).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25913216 2015 The expression of astrocyte elevated gene-1 in human non-small-cell lung cancer and its relationship with postoperative chemotherapy and radiotherapy.
25902416 2015 Knockdown of metadherin inhibits angiogenesis in breast cancer.
25880337 2015 Astrocyte elevated gene-1(AEG-1) induces epithelial-mesenchymal transition in lung cancer through activating Wnt/?-catenin signaling.
25824750 2015 Overexpression of astrocyte elevated gene-1 (AEG-1) in cervical cancer and its correlation with angiogenesis.
25794773 2015 MiR-153 inhibits epithelial-mesenchymal transition by targeting metadherin in human breast cancer.
25787750 2015 A Huaier polysaccharide reduced metastasis of human hepatocellular carcinoma SMMC-7721 cells via modulating AUF-1 signaling pathway.
25695541 2015 Astrocyte elevated gene-1 promotes progression of cervical squamous cell carcinoma by inducing epithelial-mesenchymal transition via Wnt signaling.
25684730 2015 Repression of metadherin inhibits biological behavior of prostate cancer cells and enhances their sensitivity to cisplatin.
25652471 2015 Apoptosis of human non-small-cell lung cancer A549 cells triggered by evodiamine through MTDH-dependent signaling pathway.
25575438 2015 Metadherin contributes to the pathogenesis of chronic lymphocytic leukemia partially through Wnt/?-catenin pathway.
25484183 2015 AEG-1 3'-untranslated region functions as a ceRNA in inducing epithelial-mesenchymal transition of human non-small cell lung cancer by regulating miR-30a activity.
25483832 2015 Overexpression of astrocyte-elevated gene-1 is associated with ovarian cancer development and progression.
25432696 2015 MicroRNA-542-3p suppresses cell growth of gastric cancer cells via targeting oncogene astrocyte-elevated gene-1.
25431427 2014 RNA interference-mediated knockdown of astrocyte elevated gene-1 inhibits growth, induces apoptosis, and increases the chemosensitivity to 5-fluorouracil in renal cancer Caki-1 cells.
25428378 2015 MiR-145 acts as a metastasis suppressor by targeting metadherin in lung cancer.
25417825 2014 MTDH mediates trastuzumab resistance in HER2 positive breast cancer by decreasing PTEN expression through an NF?B-dependent pathway.
25407490 2015 High expression of astrocyte elevated gene-1 is associated with clinical staging, metastasis, and unfavorable prognosis in gastric carcinoma.
25346496 2015 Metadherin exon 11 skipping variant enhances metastatic spread of ovarian cancer.
25333261 2014 miR-145 inhibits tumor growth and metastasis by targeting metadherin in high-grade serous ovarian carcinoma.
25323629 2015 microRNA-22 acts as a metastasis suppressor by targeting metadherin in gastric cancer.
25304263 2014 Astrocyte elevated gene-1 interacts with Akt isoform 2 to control glioma growth, survival, and pathogenesis.
25204501 2014 Astrocyte elevated gene-1 (AEG-1) promotes osteosarcoma cell invasion through the JNK/c-Jun/MMP-2 pathway.
25197376 2014 Prognostic significance of astrocyte elevated gene-1 in human astrocytomas.
25193383 2014 Genetic deletion of AEG-1 prevents hepatocarcinogenesis.
25182604 2015 Expression of astrocyte elevated gene-1 (AEG-1) in human meningiomas and its roles in cell proliferation and survival.
25174891 2014 Overexpression of metadherin mediates metastasis of osteosarcoma by regulating epithelial-mesenchymal transition.
25125681 2014 AEG-1 regulates retinoid X receptor and inhibits retinoid signaling.
25092897 2014 Uncontrolled inflammation induced by AEG-1 promotes gastric cancer and poor prognosis.
25074613 2014 Genetic ablation of metadherin inhibits autochthonous prostate cancer progression and metastasis.
25050974 2014 HBx elevates oncoprotein AEG-1 expression to promote cell migration by downregulating miR-375 and miR-136 in malignant hepatocytes.
24989027 2014 Expression of astrocyte elevated gene-1 (AEG-1) as a biomarker for aggressive pancreatic ductal adenocarcinoma.
24981741 2014 MTDH-SND1 interaction is crucial for expansion and activity of tumor-initiating cells in diverse oncogene- and carcinogen-induced mammary tumors.
24963474 2014 Metadherin, p50, and p65 expression in epithelial ovarian neoplasms: an immunohistochemical study.
24946951 2014 Metadherin expression and lung relapse in patients with colorectal carcinoma.
24941119 2014 AEG-1 promotes anoikis resistance and orientation chemotaxis in hepatocellular carcinoma cells.
24855648 2014 Astrocyte elevated gene-1 is a novel modulator of HIV-1-associated neuroinflammation via regulation of nuclear factor-?B signaling and excitatory amino acid transporter-2 repression.
24829520 2014 Astrocyte elevated gene-1 mediates glycolysis and tumorigenesis in colorectal carcinoma cells via AMPK signaling.
24829140 2014 AEG-1 is associated with tumor progression in nonmuscle-invasive bladder cancer.
24817955 2014 Metadherin contribute to BCR signaling in chronic lymphocytic leukemia.
24705862 2014 Astrocyte elevated gene-1 activates MMP9 to increase invasiveness of colorectal cancer.
24675891 2014 Knockdown of astrocyte elevated gene-1 (AEG-1) in cervical cancer cells decreases their invasiveness, epithelial to mesenchymal transition, and chemoresistance.
24674449 2014 A replication study of GWAS findings in migraine identifies association in a Swedish case-control sample.
24659263 2014 Association of the human astrocyte elevated gene-1 promoter variants with susceptibility to hepatocellular carcinoma.
24656097 2014 Expression of AEG-1 and microvessel density correlates with metastasis and prognosis of oral squamous cell carcinoma.
24529480 2014 Regulation of the localisation and function of the oncogene LYRIC/AEG-1 by ubiquitination at K486 and K491.
24495449 2014 MTDH/AEG-1 contributes to central features of the neoplastic phenotype in bladder cancer.
24462870 2014 Knockdown of astrocyte elevated gene-1 inhibits tumor growth and modifies microRNAs expression profiles in human colorectal cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256614 2013 High expression of astrocyte elevated gene-1 (AEG-1) is associated with progression of cervical intraepithelial neoplasia and unfavorable prognosis in cervical cancer.
24136747 2014 Astrocyte elevated gene-1 is a novel biomarker of epithelial-mesenchymal transition and progression of hepatocellular carcinoma in two China regions.
24119914 2014 Astrocyte elevated gene-1 overexpression in histologically favorable Wilms tumor is related to poor prognosis.
24063540 2013 Astrocyte elevated gene-1 is associated with metastasis in head and neck squamous cell carcinoma through p65 phosphorylation and upregulation of MMP1.
23910058 2014 In vitro regulation of hepatocellular carcinoma cell viability, apoptosis, invasion, and AEG-1 expression by LY294002.
23889992 2013 AEG-1/MTDH/LYRIC in liver cancer.
23889991 2013 The role of AEG-1/MTDH/LYRIC in the pathogenesis of central nervous system disease.
23889990 2013 Drug resistance mediated by AEG-1/MTDH/LYRIC.
23889989 2013 Pleiotropic roles of AEG-1/MTDH/LYRIC in breast cancer.
23889988 2013 AEG-1/MTDH/LYRIC: signaling pathways, downstream genes, interacting proteins, and regulation of tumor angiogenesis.
23889987 2013 AEG-1/MTDH/LYRIC: clinical significance.
23889986 2013 AEG-1/MTDH/LYRIC, the beginning: initial cloning, structure, expression profile, and regulation of expression.
23851509 2014 MicroRNA-30a suppresses breast tumor growth and metastasis by targeting metadherin.
23835593 2013 Overexpression of astrocyte-elevated gene-1 is associated with cervical carcinoma progression and angiogenesis.
23710918 2013 [Expression of astrocyte elevated gene-1 protein and its clinical significance in laryngeal squamous cell carcinoma].
23640911 2013 AEG-1 participates in TGF-beta1-induced EMT through p38 MAPK activation.
23595222 2013 Metadherin confers chemoresistance of cervical cancer cells by inducing autophagy and activating ERK/NF-?B pathway.
23499911 2013 AEG-1 overexpression is essential for maintenance of malignant state in human AML cells via up-regulation of Akt1 mediated by AURKA activation.
23408429 2013 The oncogene metadherin modulates the apoptotic pathway based on the tumor necrosis factor superfamily member TRAIL (Tumor Necrosis Factor-related Apoptosis-inducing Ligand) in breast cancer.
23364922 2013 Increased expression of metadherin protein predicts worse disease-free and overall survival in laryngeal squamous cell carcinoma.
23307243 2013 AEG-1 expression characteristics in human non-small cell lung cancer and its relationship with apoptosis.
23240043 2012 The MTDH (-470G>A) polymorphism is associated with ovarian cancer susceptibility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142337 2013 Expression characteristics of astrocyte elevated gene-1 (AEG-1) in tongue carcinoma and its correlation with poor prognosis.
23065261 2012 Prognostic impact of Metadherin-SND1 interaction in colon cancer.
23023948 2012 Expression of AEG-1 in human T-cell lymphoma enhances the risk of progression.
23011158 2012 AEG-1 is associated with clinical outcome in neuroblastoma patients.
22967897 2012 MiR-136 promotes apoptosis of glioma cells by targeting AEG-1 and Bcl-2.
22938468 2012 Deregulation of MTDH gene expression in gastric cancer.
22903204 2014 Overexpression of metadherin/MTDH is associated with an aggressive phenotype and a poor prognosis in invasive breast cancer.
22898150 2012 Metadherin is a novel prognostic marker for bladder cancer progression and overall patient survival.
22768080 2012 Metadherin contributes to the pathogenesis of diffuse large B-cell lymphoma.
22689379 2012 Astrocyte elevated gene-1 promotes hepatocarcinogenesis: novel insights from a mouse model.
22684557 2012 Expression of metadherin/AEG-1 gene is positively related to orientation chemotaxis and adhesion of human hepatocellular carcinoma cell lines of different metastatic potentials.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22643064 2012 Expression of AEG-1 mRNA and protein in colorectal cancer patients and colon cancer cell lines.
22470125 2012 Prognostic significance of metadherin overexpression in hepatitis B virus-related hepatocellular carcinoma.
22431469 2013 Astrocyte elevated gene-1 interacts with ?-catenin and increases migration and invasion of colorectal carcinoma.
22372608 2012 Elevated expression of astrocyte elevated gene-1 (AEG-1) is correlated with cisplatin-based chemoresistance and shortened outcome in patients with stages III-IV serous ovarian carcinoma.
22367022 2012 Metadherin regulates radioresistance in cervical cancer cells.
22351252 2012 Clinical implications of AEG-1 in liver metastasis of colorectal cancer.
22340175 2011 Astrocyte elevated gene-1 induces breast cancer proliferation and invasion through upregulating HER2/neu expression.
22246354 2011 [Expression of EphA7 and MTDH and clinicopathological significance in the squamous cell cancer of the tongue].
22204714 2012 Overexpression of astrocyte-elevated gene-1 is closely correlated with poor prognosis in human non-small cell lung cancer and mediates its metastasis through up-regulation of matrix metalloproteinase-9 expression.
22199357 2012 Cytoplasmic Metadherin (MTDH) provides survival advantage under conditions of stress by acting as RNA-binding protein.
22195048 2011 Metadherin mediates lipopolysaccharide-induced migration and invasion of breast cancer cells.
22133054 2011 Astrocyte elevated gene-1 (AEG-1) is a marker for aggressive salivary gland carcinoma.
22056881 2012 MicroRNA-375 targets AEG-1 in hepatocellular carcinoma and suppresses liver cancer cell growth in vitro and in vivo.
22031094 2011 Significance of dysregulated metadherin and microRNA-375 in head and neck cancer.
21976539 2011 Metadherin promotes hepatocellular carcinoma metastasis through induction of epithelial-mesenchymal transition.
21964981 2013 MTDH and EphA7 are markers for metastasis and poor prognosis of gallbladder adenocarcinoma.
21957284 2011 The cellular protein lyric interacts with HIV-1 Gag.
21852380 2011 Oncogene AEG-1 promotes glioma-induced neurodegeneration by increasing glutamate excitotoxicity.
21753766 2011 Tumor suppressive microRNA-375 regulates oncogene AEG-1/MTDH in head and neck squamous cell carcinoma (HNSCC).
21750868 2011 Astrocyte elevated gene-1 overexpression in human primary gallbladder carcinomas: an unfavorable and independent prognostic factor.
21750404 2011 Oncogenic roles of astrocyte elevated gene-1 (AEG-1) in osteosarcoma progression and prognosis.
21609571 2011 [Expression of ephrin-A7 and metadherin and its clinicopathological significances in the benign and malignant lesions of gallbladder].
21543927 2011 AEG -1 overexpression: a novel indicator for peritoneal dissemination and lymph node metastasis in epithelial ovarian cancers.
21495225 2010 Expression of astrocyte elevated gene-1: a novel marker of the pathogenesis, progression, and poor prognosis for endometrial cancer.
21478147 2011 Identification of staphylococcal nuclease domain-containing 1 (SND1) as a Metadherin-interacting protein with metastasis-promoting functions.
21448238 2011 Meta-analysis of genome-wide association for migraine in six population-based European cohorts.
21412050 2011 Astrocyte elevated gene-1 activates AMPK in response to cellular metabolic stress and promotes protective autophagy.
21408129 2011 Identification of novel variants of metadherin in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21371176 2011 Metadherin enhances the invasiveness of breast cancer cells by inducing epithelial to mesenchymal transition.
21293286 2011 Clinical significance of astrocyte elevated gene-1 expression in human epithelial ovarian carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21259255 2011 Significance of AEG-1 expression in correlation with VEGF, microvessel density and clinicopathological characteristics in triple-negative breast cancer.
21256156 2011 Astrocyte elevated gene-1 (AEG-1): A multifunctional regulator of normal and abnormal physiology.
21150314 2011 Astrocyte-elevated gene-1 (AEG-1): Glioblastoma's helping hand during times of hypoxia and glucose deprivation?
21127263 2010 Astrocyte elevated gene-1 induces protective autophagy.
21084864 2011 Astrocyte-elevated gene-1 (AEG-1) induction by hypoxia and glucose deprivation in glioblastoma.
20952513 2011 Pathologically decreased miR-26a antagonizes apoptosis and facilitates carcinogenesis by targeting MTDH and EZH2 in breast cancer.
20845990 2010 Overexpression of AEG-1 in renal cell carcinoma and its correlation with tumor nuclear grade and progression.
20802479 2010 Genome-wide association study of migraine implicates a common susceptibility variant on 8q22.1.
20625905 2010 Prognostic significance of AEG-1 expression in colorectal carcinoma.
20565850 2010 Immunohistochemical analysis of Metadherin in proliferative and cancerous breast tissue.
20388796 2010 Molecular mechanism of chemoresistance by astrocyte elevated gene-1.
20388776 2010 Astrocyte elevated gene-1 upregulates matrix metalloproteinase-9 and induces human glioma invasion.
20300973 2011 Astrocyte-elevated gene-1 overexpression is associated with poor prognosis in gastric cancer.
20236756 2010 Clinical significance of astrocyte elevated gene-1 expression in human oligodendrogliomas.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20053777 2010 Astrocyte elevated gene-1: a novel target for human glioma therapy.
19940250 2009 Astrocyte elevated gene-1 (AEG-1) functions as an oncogene and regulates angiogenesis.
19740331 2009 Astrocyte elevated gene-1 (AEG-1) is induced by lipopolysaccharide as toll-like receptor 4 (TLR4) ligand and regulates TLR4 signalling.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648967 2009 Nuclear LYRIC/AEG-1 interacts with PLZF and relieves PLZF-mediated repression.
19633686 2009 Astrocyte elevated gene-1 is a proliferation promoter in breast cancer via suppressing transcriptional factor FOXO1.
19448665 2009 Astrocyte elevated gene-1 contributes to the pathogenesis of neuroblastoma.
19433866 2009 Rrs1 is involved in endoplasmic reticulum stress response in Huntington disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19383828 2009 LYRIC/AEG-1 is targeted to different subcellular compartments by ubiquitinylation and intrinsic nuclear localization signals.
19304953 2009 Overexpression of astrocyte elevated gene-1 (AEG-1) is associated with esophageal squamous cell carcinoma (ESCC) progression and pathogenesis.
19221438 2009 Astrocyte elevated gene-1 regulates hepatocellular carcinoma development and progression.
19111877 2009 MTDH activation by 8q22 genomic gain promotes chemoresistance and metastasis of poor-prognosis breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519759 2008 Astrocyte elevated gene-1 is a novel prognostic marker for breast cancer progression and overall patient survival.
18440304 2008 LYRIC/AEG-1 overexpression modulates BCCIPalpha protein levels in prostate tumor cells.
18316612 2008 Molecular basis of nuclear factor-kappaB activation by astrocyte elevated gene-1.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17704808 2008 Astrocyte elevated gene-1 activates cell survival pathways through PI3K-Akt signaling.
17563745 2007 Knockdown of astrocyte-elevated gene-1 inhibits prostate cancer progression through upregulation of FOXO3a activity.
17397930 2007 Astrocyte elevated gene-1: recent insights into a novel gene involved in tumor progression, metastasis and neurodegeneration.
17088530 2006 Astrocyte elevated gene-1 (AEG-1) is a target gene of oncogenic Ha-ras requiring phosphatidylinositol 3-kinase and c-Myc.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16452207 2006 Activation of the nuclear factor kappaB pathway by astrocyte elevated gene-1: implications for tumor progression and metastasis.
15927426 2005 Cloning and characterization of HIV-1-inducible astrocyte elevated gene-1, AEG-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383321 2004 Identification of a novel protein, LYRIC, localized to tight junctions of polarized epithelial cells.
15093543 2004 Metadherin, a cell surface protein in breast tumors that mediates lung metastasis.
14980505 2004 3D3/lyric: a novel transmembrane protein of the endoplasmic reticulum and nuclear envelope, which is also present in the nucleolus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11823860 2002 Gene expression profiling predicts clinical outcome of breast cancer.