Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.68
PubTator Score 33.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 2.0e-03
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.250 2.0e-03

Synonym

Accession P56278 Q5HYP2 p13MTCP1
Symbols p8MTCP1
P13MTCP1

Gene

PDB

1A1X   1QTT   1QTU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25472883 HIV-1 Tat specifically associates with MTCP1 promoter to upregulate MTCP1 expression in T cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
17136114 Transgenic mice overexpressing MTCP1 develop leukemias with a CD8 central memory phenotype in most cases.

AA Sequence

MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQ      1 - 70
LYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD                                      71 - 107
//

Text Mined References (21)

PMID Year Title
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17136114 2007 The MTCP1 oncogene modifies T-cell homeostasis before leukemogenesis in transgenic mice.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10983986 2000 The protooncogene TCL1 is an Akt kinase coactivator.
10959629 2000 Backbone dynamics and solution structure refinement of the 15N-labeled human oncogenic protein p13MTCP1: comparison with X-ray data.
9691281 1998 Solution structure of the recombinant human oncoprotein p13MTCP1.
9520380 1998 Crystal structure of MTCP-1: implications for role of TCL-1 and MTCP-1 in T cell malignancies.
9518463 1998 Purification and characterization of recombinant forms of TCL-1 and MTCP-1 proteins.
9315101 1997 Alternative origin of p13MTCP1-encoding transcripts in mature T-cell proliferations with t(X;14) translocations.
8634440 1996 Expression of p13MTCP1 is restricted to mature T-cell proliferations with t(X;14) translocations.
8361760 1993 MTCP-1: a novel gene on the human chromosome Xq28 translocated to the T cell receptor alpha/delta locus in mature T cell proliferations.
8247530 1993 The chromosomal translocation t(X;14)(q28;q11) in T-cell pro-lymphocytic leukaemia breaks within one gene and activates another.
8152252 1994 A gene on chromosome Xq28 associated with T-cell prolymphocytic leukemia in two patients with ataxia telangiectasia.
1303175 1992 Isolation and sequence of two genes associated with a CpG island 5' of the factor VIII gene.