Property Summary

Ligand Count 68
NCBI Gene PubMed Count 68
PubMed Score 189.90
PubTator Score 187.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.094 2.2e-05
lung carcinoma -1.100 3.2e-26
malignant mesothelioma 1.100 3.9e-05
medulloblastoma 1.100 5.8e-03
medulloblastoma, large-cell 1.600 1.9e-03
ovarian cancer 1.100 2.9e-04
primitive neuroectodermal tumor 1.100 4.0e-04
psoriasis -1.100 2.3e-03

Gene RIF (53)

AA Sequence

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPS      1 - 70
KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM     71 - 140
AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI    141 - 210
CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL    211 - 280
PRH                                                                       281 - 283
//

Text Mined References (77)

PMID Year Title