Property Summary

NCBI Gene PubMed Count 31
PubMed Score 20.11
PubTator Score 20.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.216 2.4e-03
ependymoma 1.100 4.2e-08
atypical teratoid / rhabdoid tumor 1.900 1.1e-08
glioblastoma 1.300 1.4e-03
medulloblastoma -1.100 3.4e-04
medulloblastoma, large-cell -1.800 3.7e-05
primitive neuroectodermal tumor 1.300 5.3e-03
adrenocortical carcinoma -1.016 9.0e-06
non-small cell lung cancer 1.431 3.1e-30
adult high grade glioma -1.200 6.3e-04
subependymal giant cell astrocytoma -1.084 3.7e-02
lung adenocarcinoma 1.300 8.0e-12

Protein-protein Interaction (8)

Gene RIF (16)

PMID Text
26483332 MTA3 suppress apoptosis of A549 an H157 cells by inhibiting BAX, PARP expression.
26198267 role in terminal trophoblast differentiation
25319202 This review focuses on the current knowledge about the function and regulation of MTA1 and MTA3 proteins in gynecological cancer, including ovarian, endometrial, and cervical tumors.
24293376 Using western blotting and luciferase assays, MTA3 was identified as a target of miR-495
24107548 MAT3 over-expression in non-small cell lung carcinoma and MAT3 mRNA level is a risk factor for lymph node metastasis and survival.
23671646 MTA3 expression is an independent prognostic factor in patients with gastroesophageal junction adenocarcinoma.
23510993 Down-regulation of MTA3 and up-regulation of CGB5 and Snail are associated with preeclampsia.
20865667 MTA3 is not a useful marker to assess and identify high-risk patients with endometrial adenocarcinomas
19363681 the high expression level of MTA proteins in human chorionic cells might facilitate trophoblast cell migration and neoangiogenesis
17050676 These findings identify MTA3 as an upstream physiologic repressor of Wnt4 in mammary epithelial cells.
16502042 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15454082 a cell type-specific subunit of the corepressor complex Mi-2/NuRD,a cofactor for BCL-6-dependent B cell fate determination.
15358836 Molecular dissection of the MTA3 promoter using transient transfection assays identified a composite element required for high-level transcription consisting of an SP1 site in close proximity to a consensus estrogen response element half-site.
15169784 estrogen receptor-alpha regulates metastatic tumor antigen 3 pathway
12920132 MTA3 does not repress transcription to a significant level and appears to have a diffused pattern of subcellular localization, suggesting a biological role distinct from that of the other two MTA proteins.
12705869 The absence of MTA3 leads to aberrant expression of Snail, a master regulator of epithelial to mesenchymal transitions. This results in loss of expression of E-cadherin, causing changes in epithelial architecture and invasive growth.

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEES      1 - 70
ETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSL     71 - 140
KTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARAL    141 - 210
DCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFE    211 - 280
EALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQI    281 - 350
STSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPT    351 - 420
QSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLR    421 - 490
QAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRSTPSLQTPTTK    491 - 560
RMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD                                        561 - 594
//

Text Mined References (34)

PMID Year Title
26869315 2016 Structure, expression and functions of MTA genes.
26483332 2015 [Regulation Mechanism of MTA3 in the Apoptosis of NSCLC Cells].
26198267 2015 MTA3 regulates differentiation of human cytotrophoblast stem cells.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25319202 2014 Function and regulation of MTA1 and MTA3 in malignancies of the female reproductive system.
25315816 2014 Identification and characterization of metastasis-associated gene/protein 1 (MTA1).
24293376 2014 MiR-495 regulates proliferation and migration in NSCLC by targeting MTA3.
24107548 2013 Analysis of MAT3 gene expression in NSCLC.
23671646 2013 The metastasis-associated gene MTA3, a component of the Mi-2/NuRD transcriptional repression complex, predicts prognosis of gastroesophageal junction adenocarcinoma.
23510993 2013 MTA3 regulates CGB5 and Snail genes in trophoblast.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20865667 2010 The metastasis-associated gene MTA3 is downregulated in advanced endometrioid adenocarcinomas.
19363681 2009 The metastasis-associated genes MTA1 and MTA3 are abundantly expressed in human placenta and chorionic carcinoma cells.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17050676 2006 Metastatic tumor antigen 3 is a direct corepressor of the Wnt4 pathway.
16502042 2006 Breast cancer risk associated with genotypic polymorphism of the genes involved in the estrogen-receptor-signaling pathway: a multigenic study on cancer susceptibility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454082 2004 MTA3 and the Mi-2/NuRD complex regulate cell fate during B lymphocyte differentiation.
15358836 2004 Hormonal regulation of metastasis-associated protein 3 transcription in breast cancer cells.
15169784 2004 Upstream determinants of estrogen receptor-alpha regulation of metastatic tumor antigen 3 pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14613024 2003 Emerging roles of MTA family members in human cancers.
12920132 2003 The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
12705869 2003 MTA3, a Mi-2/NuRD complex subunit, regulates an invasive growth pathway in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483358 2001 Differential expression and subcellular distribution of the mouse metastasis-associated proteins Mta1 and Mta3.
11181995 2001 The sequence of the human genome.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10471500 1999 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation.