Property Summary

NCBI Gene PubMed Count 159
PubMed Score 184.67
PubTator Score 197.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.100 2.9e-02
ependymoma 1.900 2.1e-02
psoriasis -1.600 2.2e-04
medulloblastoma 1.900 1.8e-04
astrocytoma 1.600 1.8e-02
atypical teratoid / rhabdoid tumor 1.900 5.3e-08
glioblastoma 1.400 1.0e-05
medulloblastoma, large-cell 2.500 2.7e-06
primitive neuroectodermal tumor 1.100 3.3e-04
autosomal dominant Emery-Dreifuss muscul... 1.086 3.4e-03
juvenile dermatomyositis 1.202 5.5e-10
lung cancer 1.400 2.0e-04
gastric carcinoma 1.300 1.9e-02
ovarian cancer 1.900 1.5e-06

Gene RIF (130)

PMID Text
27048111 RNAi aiming at MTA1 can effectively inhibit the expression of MTA1 in endometrial carcinoma Ishikawa cells
26698569 We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma
26689197 MTA1 plays an important role in Epithelial-to-mesenchymal transition (EMT) to promote metastasis via suppressing E-cadherin expression, resulting in a poor prognosis in MPM. MTA1 is a novel biomarker and indicative of a poor prognosis in MPM patients
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26503703 Inhibition of MTA1 by ERalpha contributes to protection hepatocellular carcinoma from tumor proliferation and metastasis
26168722 MTA1 dysregulation in a subset of salivary gland cancer might promote aggressive phenotypes by compromising the tumor suppressor activity of ERbeta
25998575 report demonstrates that miR-125a-3p inhibits the proliferation, migration, and invasion of NSCLC cells through down-regulation of MTA1
25977170 MTA1 is associated with the aggressive nature of pituitary tumors and may be a potential therapeutic target in this tumor type.
25797255 protein abundance of YB-1 and MTA1, irrespective of DNA or mRNA status, can predict for prostate cancer relapse and uncover a vast underappreciated repository of biomarkers regulated at the level of protein expression.
25688501 MTA1 might be important biological marker involved in the carcinogenesis, metastasis, and invasion of gallbladder adenocarcinoma, and MTA1 is an independent factor of prognosis.
25502548 MTA1 plays a critical role in regulating the malignant behaviors of small cell lung cancer
25501238 Results show that MTA1 promotes the proliferation of epithelial ovarian cancer cells by enhancing DNA repair.
25416046 MTA1 expression was significantly associated with poor metastasis-free survival in nasopharyngeal carcinoma patients.
25374266 Taken together, current literature suggests that MTA proteins, especially MTA1, act as a master co-regulatory molecule involved in the carcinogenesis and progression of various malignant tumors
25359583 This review gives a brief account on the existing biological and molecular data in the context of head and neck cancer invasion and metastasis in relation to MTA1.
25352341 In this review, we summarise the structure and function of the four domains of MTA1 and discuss the possible functions of less well-characterised regions of the protein.
25344802 the concept of the dynamic nature of corepressor versus coactivator complexes and the MTA1 proteome as a function of time to signal is likely to be generally applicable to other multiprotein regulatory complexes in living systems.
25332146 Recent studies demonstrating the bi-regulatory nature of MTA1 challenged the conventional paradigm of MTA function and raised many questions in fully understanding their roles in cancer progression
25332145 propose that MTA1 is a stress response protein that is upregulated in various stress-related situations such as heat shock, hypoxia, and ironic radiation.
25332144 Therefore, targeting MTA1 would not only suppress tumor progression but also greatly sensitize cancer cells to DNA damage-based radio- and chemotherapies
25332143 MTA1 is involved in prostate tumor angiogenesis by regulating several pro-angiogenic factors. Evidence for MTA1 as a prognostic marker for aggressive prostate cancer and disease recurrence has been described.
25319202 This review focuses on the current knowledge about the function and regulation of MTA1 and MTA3 proteins in gynecological cancer, including ovarian, endometrial, and cervical tumors.
25315817 In this review, we described various molecular studies of osteosarcoma, especially associated with MTA1.
25315816 In this review, we will briefly discuss the researches for the identification and characterization of the mta1 gene, its human counterpart MTA1, and their protein products
25301048 High expression of the MTA1 protein was seen in oral squamous cell carcinoma, and was closely associated with tumor progression and increased tumor angiogenesis.
25245523 MTA1 plays a critical role in promoting cisplatin resistance in nasopharyngeal carcinoma cells by regulating cancer stem cell properties via the PI3K/Akt signaling pathway.
25205035 MTA1 drove a global decondensation of chromatin structure, it changed the expression of only a small proportion of genes.
24920672 RbAp48 recognizes MTA1 using the same site that it uses to bind histone H4, showing that assembly into NuRD modulates RbAp46/48 interactions with histones.
24853685 Inhibition of cancer migration and attachment induced by IgG down-regulation might be achieved through the MTA1 regulatory pathway.
24424621 These results demonstrate a novel role for MTA1 in the regulation of esophageal squamous cell carcinoma invasion and provide insight into the mechanisms involved in this process.
24413532 MTA1-TFAP2C or the MTA1-IFI16 complex may contribute to the epigenetic regulation of ESR1 expression.
24265228 Crosstalk between VEGF and MTA1 signaling pathways contribute to aggressiveness of breast carcinoma.
24214543 MTA1 gene plays an important role in progressiona and metastasis of ovarian cancers.
24089055 MTA1 has an important role in the maintenance of circadian rhythmicity.
23941622 MTA1 promotes nasopharyngeal carcinoma cell proliferation via enhancing G1 to S phase transition, leading to increased tumor growth.
23900262 We concluded that MTA1 nuclear overexpression may be a prognostic indicator and a future therapeutic target for aggressive PCa in African American men
23866297 Metastasis-associated protein 1 is a novel marker predicting survival and lymph nodes metastasis in cervical cancer.
23831020 MTA1 acts as a potent corepressor of the nuclear receptor NR4A1 transcription by interacting with HDAC2 and may serve as a novel DTX-resistance promoter in PC-3 cells
23803414 BCL11B and metastasis associated 1 protein (MTA1) inhibits HIV-1 Tat-mediated LTR transactivation by association with the integrated HIV-LTR
23791785 The structure of HDAC1 in complex with MTA1 from the NuRD complex is reported.
23718732 MTA1 and miR-125b have antagonistic effects on the migration and invasion of NSCLC cells.
23618874 we have demonstrated a critical role of MTA1 in regulating NPC metastasis. This kind of role is associated with its influence on cytoskeleton organization. Rho GTPases and Hedgehog signaling are involved in MTA1-mediated metastasis promotion.
23592142 These results demonstrated that MTA1 played an important role in the cell metastasis in ovarian cancer.
23371285 High MTA-1 expression is associated with metastasis and epithelial to mesenchymal transition in colorectal cancer.
23352453 MTA1 possesses an inherent histone amplifier activity with an instructive role in impacting the epigenetic landscape.
23343746 These findings demonstrate that MTA1 protein plays important roles in regulating the migration, invasion, and angiogenesis potentials of 95D cells.
23283219 MTA1 overexpression is frequently observed in node-negative gastric cancer patients and is significantly associated with increased angiogenesis and poor prognosis.
23227138 results demonstrate that MTA1 plays an important role in controlling the malignant transformation of prostate cancer cells through the p-AKT/E-cadherin pathway
22864797 Overexpression of MTA1 is associated with Breast Cancer.
22844865 The conversely abnormal expression levels of MTA1 and RECK may be collectively involved in progression of malignancies and may serve as molecular predictors for metastasis, recurrence, and prognosis of nasopharyngeal carcinoma.
22700976 Metastasis-associated protein 1/histone deacetylase 4-nucleosome remodeling and deacetylase complex regulates phosphatase and tensin homolog gene expression and function.
22576802 MTA1 functions in regulating the invasive phenotype of lung cancer cells and this regulation may be through altered miRNA expression
22575258 Metastasis-associated protein 1 staining is not ideal for investigating the possible malignant nature of smaller metastases because of the relatively low concordance between the primary tumor and metastases.
22547301 MTA1 gene overexpression can be used as a molecular biological marker to predict the prognosis of middle esophageal squamous cell carcinoma.
22537306 results of this study suggest that nuclear overexpression of MTA1 correlates significantly with poorer disease free survival and poorer overall survival in nasopharyngeal carcinoma
22286760 the MTA1 gene is a target of p53-mediated transrepression
22270988 High expression of MTA1 protein is closely associated with esophageal tumor progression, increased tumor angiogenesis, and poor survival.
22270359 Leptin-induced epithelial-mesenchymal transition in breast cancer cells requires beta-catenin activation via Akt/GSK3- and MTA1/Wnt1 protein-dependent pathways.
22253283 Study reveals several new physiologic functions of MTA1 related to DNA damage, inflammatory responses, and infection, in which MTA1 functions as a permissive "gate keeper" for cancer-causing parasites.
22176993 MTA1 may play a role in promoting cervical cancer cell invasion, migration, adhesion, as well as cell growth and colony formation.
22139444 MiR-30c was directly bound to the 3'-untranslated regions of MTA1.
22098246 The genetic polymorphism IVS4-81G/A in MTA1 were correlated with MTA1 overexpression and may be an important risk factor for the recurrence of hepatocellular carcinoma.
22022494 The fine coordination between MTA1 and p53 in pachytene spermatocytes upon hyperthermal stimulation, was investigated.
21965678 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function
21949998 Aberrant expression of MTA1 and RECK gene may be involved in the invasion and metastasis of nasopharyngeal carcinoma.
21892752 MTA1may play an important role in the smoked-related progress of non-small cell lung cancer
21837953 MTA1 siRNA can inhibit the anchorage-independent growth of prostate cancer cells by inducing anoikis.
21835429 Metastasis tumor antigen 1 overexpression can be used as a predictor of clinical outcome in patients with ovarian cancer and therefore may represent a new prognostic marker.
21813470 The data suggest that EIF5A2 plays an important oncogenic role in CRC aggressiveness by the upregulation of MTA1 to induce EMT.
21725997 immunohistochemical analysis of approximately 300 liver tissue cores from confirmed cases of Opisthorchis viverrini-induced cholangiocarcinoma showed that MTA1 expression was elevated in >80% of the specimens
21661415 Barrett's esophagus (BE) with HDAC-1 and MTA-1 expression is considered to be a precancerous lesion re quiring curative treatment.
21617866 HDAC1 and MTA1 expression levels are potential prognostic indicators for colon cancer.
21595884 Silencing effect of MTA1 could efficiently inhibit the invasion and proliferation in MDA-MB-231 cells.
21555589 MTA1-mediated activation of ARF and ARF-mediated functional inhibition of MTA1 represent a p53-independent bidirectional autoregulatory mechanism in which these two opposites act in concert to regulate cell homeostasis and oncogenesis
21448429 Data suggest that MTA1, as a regulator of tumor-associated lymphangiogenesis, promotes lymphangiogenesis in colorectal cancer by mediating the VEGF-C expression.
21445634 in ileal neuroendocrine cancer, HER-2/neu overexpression plays a role in the carcinogenetic process and by triggering the altered expression of c-Met and MTA-1, may activate the molecular pathway(s) promoting tumor progression and metastasis development.
21336715 MTA1 plays an important role in the migration and invasion of cervical cancer cells.
21290196 Overexpression of metastasis-associated protein 1 is significantly correlated with tumor angiogenesis in patients with early-stage non-small cell lung cancer.
21258411 findings suggest that TGF-beta1 regulates EMT via stimulating expression of MTA1, which in turn, induces FosB to repress E-cadherin expression and thus, revealed an inherent function of MTA1 as a target and effector of TGF-beta1 signaling in epithelial cells
21240515 There was a significant correlation between the expression of MTA1 and lymph node metastasis in tonsil cancer.
21047798 RbAp48 interacts with the NuRD subunit MTA-1 via a surface that is distinct from its FOG-binding pocket, providing a first glimpse into the way in which NuRD assembly facilitates interactions with cofactors
20935042 Mta1 protein overexpression is an independent prognostic factor for patients with non-small-cell lung cancer.
20717904 MTA1 pro-angiogenic and pro-invasive functions create permissive environment for prostate tumor growth and likely support metastasis.
20697987 Increased expression of MTA1 is associated with invasive ductal breast carcinoma.
20661085 High metastasis-associated protein 1 nuclear expression is associated with non-small cell lung cancer.
20651739 Data show that induced levels of metastasis-associated protein 1 (MTA1) are sufficient to transform Rat1 fibroblasts and that the transforming potential of MTA1 is dependent on its acetylation at Lys626.
20619094 Expression of Mta-1 expression and VEGF is positively associated with the development of endometrial cancer.
20547755 identify MTA1, a subunit of the NuRD complex, as a new HIC1 corepressor.
20427275 Findings suggest that, in addition to its role in the repair of double strand breaks caused by ionizing radiation, MTA1 also participates in the UV-induced ATR-mediated DNA damage checkpoint pathway.
20071335 there is a p53-independent function of MTA1 in DNA damage response via modulation of the p21 WAF1-proliferating cell nuclear antigen pathway
20022949 These findings reveal an inherent role of MTA1 in hepatitis B virus HBx regulation of iNOS expression and consequently its function in the liver cancer cells.
19805145 MTA1 is required for optimum DNA double-strand break repair after ionizing radiation.
19584269 Results suggest that miR-661 be further investigated for therapeutic use in down-regulating the expression of MTA1 in cancer cells.
19403384 MTA1 may promote lung carcinogenesis by enhancing HIF-1alpha protein activity.
19377441 Metastasis-associated gene 1 expression is significantly associated with malignant behavior in pancreatic endocrine tumors.
19366061 ezrin and metastatic tumor antigen positivity can be additional prognostic markers in osteosarcoma of the jaw.
19363681 the high expression level of MTA proteins in human chorionic cells might facilitate trophoblast cell migration and neoangiogenesis
18769059 This study was undertaken to explore the potential role of MTA1 in mouse liver.
18768194 BCL11B and metastasis associated 1 protein (MTA1) inhibits HIV-1 Tat-mediated LTR transactivation by association with the integrated HIV-LTR
18719363 MTA1 is up-regulated in advanced ovarian cancer, represses ERbeta, and enhances expression of GRO.
18640824 Histologically, MTA1 protein production was strongly associated with cancer cell invasion, and clinically there was a correlation between lymph node metastasis and MTA1 protein production.
18362831 HIF-1alpha expression may be regulated through HDAC1/MTA1, which is associated with a poor prognosis for pancreatic carcinoma
18306220 MTA1 is closely associated with microvascular invasion, frequent postoperative recurrence, and poor survival of HCC patients, especially in those with HBV-associated HCC.
18196870 MTA1 expression was significantly higher in noninvasive breast cancer cell lines than in invasive ones.
17922035 study shows HSF1 binds to MTA1 in vitro & in breast carcinoma; repression of estrogen-dependent transcription may contribute to role of HSF1 in cancer
17922032 These findings strongly implicate MTA1 in the transcriptional repression of BRCA1 leading to abnormal centrosome number and chromosomal instability.
17868030 Results suggest that MTA1 promotes the metastatic ability of B16F10 cancer cells.
17666527 role for the MTA1 as an upstream modifier of Six3 and indicate that Six3 is a direct stimulator of rhodopsin expression.
16969516 MTA1 enhances angiogenesis by stabilization of the HIF-1alpha protein, which is closely related to the increased metastatic potential of cancer cells with high MTA1 expression
16855396 BCAS3 overexpression in hormone receptor-positive premenopausal breast cancer seemed to be associated with impaired responses to tamoxifen
16831056 These studies demonstrate that MTA1 is expressed in both benign and malignant neoplasms. While its expression is associated with tissue invasion it may not be sufficient for the progression of neoplasms to metastatic stages.
16807247 structure and antiestrogenic activity of the unique C-terminal, NR-box motif-containing region of MTA1
16646402 Overexpression of the MTA1 gene correlates with lymph node metastasis of carcinomas of the larynx.
16617102 role for MTA1-BCAS3 pathway in promoting cancerous phenotypes in breast tumor cells
16502042 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16244788 MTA1 overexpression is associated with high recurrence of breast cancer
16172399 MTA1 is one of the first downstream targets of c-MYC function that are essential for the transformation potential of c-MYC.
15254226 Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator
15095300 overexpression of MTA1 protein and acetylation level of histone H4 protein are closely related
15077195 MTA1s interacts with CKI-gamma2 in vitro and in vivo and colocalizes in the cytoplasm
14871807 This study identified an association of MTA1 expression and prostate cancer progression.
14735193 enhanced expression of MTA1 promotes the acquisition of an invasive, metastatic phenotype, and thus enhances the malignancy of pancreatic adenocarcinoma cells by modulation of the cytoskeleton
12920132 MTA1 and MTA2 repress transcription specifically, are located in the nucleus, and contain associated histone deacetylase activity; MTA1 associates with a different set of transcription factors from MTA2
12684630 High expression of the MTA1 gene is associated with hepatocellular carcinoma
12650603 The results suggest that the MTA1 protein may serve multiple functions in cellular signaling, chromosome remodeling and transcription processes that are important in the progression, invasion and growth of metastatic epithelial cells.
12527756 interaction with MAT1 and regulation of estrogen receptor transactivation functions
12431981 MTA1 binds to the MMP-9 promoter, thereby repressing expression of this type IV collagenase via histone-dependent and independent mechanisms
12167865 naturally occurring short form that contains a previously unknown sequence of 33 amino acids with an ER-binding motif, Leu-Arg-Ile-Leu-Leu (LRILL); MTA1s localizes in the cytoplasm, sequesters ER in the cytoplasm, and enhances non-genomic responses of ER
11948399 metastasis-associated protein (MTA)1 enhances migration, invasion, and anchorage-independent survival of immortalized human keratinocytes
11804687 expression is closely related to invasiveness and metastasis in non-small-cell lung carcinoma

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYK      1 - 70
AGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSY     71 - 140
LEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQI    141 - 210
DQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVL    211 - 280
CRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESK    281 - 350
LKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC    351 - 420
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREIL    421 - 490
RPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVL    491 - 560
SSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPT    561 - 630
KVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP    631 - 700
PPPAPVNDEPIVIED                                                           701 - 715
//

Text Mined References (172)

PMID Year Title
27048111 2016 Effects of silencing MTA1 gene by RNA interference on invasion and metastasis of endometrial carcinoma.
26869315 2016 Structure, expression and functions of MTA genes.
26698569 2015 MTA1-upregulated EpCAM is associated with metastatic behaviors and poor prognosis in lung cancer.
26689197 2015 MTA1 promotes metastasis of MPM via suppression of E-cadherin.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26503703 2015 Inhibition of MTA1 by ER? contributes to protection hepatocellular carcinoma from tumor proliferation and metastasis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168722 2015 MTA1 regulation of ER? pathway in salivary gland carcinoma cells.
26028330 2015 Dysfunction of the Reciprocal Feedback Loop between GATA3- and ZEB2-Nucleated Repression Programs Contributes to Breast Cancer Metastasis.
25998575 2015 miR-125a-3p targets MTA1 to suppress NSCLC cell proliferation, migration, and invasion.
25977170 Expression of metastasis-associated gene-1 is associated with bone invasion and tumor stage in human pituitary adenomas.
25797255 2015 YB-1 and MTA1 protein levels and not DNA or mRNA alterations predict for prostate cancer recurrence.
25688501 Overexpression of MTA1 and loss of KAI-1 and KiSS-1 expressions are associated with invasion, metastasis, and poor-prognosis of gallbladder adenocarcinoma.
25502548 2015 MTA1 downregulation inhibits malignant potential in a small cell lung cancer cell line.
25501238 2014 MTA1 promotes cell proliferation via DNA damage repair in epithelial ovarian cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25416046 2014 Expression of MTA1 in nasopharyngeal carcinoma and its correlation with prognosis.
25374266 2014 Clinical implications of MTA proteins in human cancer.
25359583 2014 Role of MTA1 in head and neck cancers.
25352341 2014 Towards an understanding of the structure and function of MTA1.
25344802 2014 Role of MTA1 in cancer progression and metastasis.
25332146 2014 Post-transcriptional regulation of MTA family by microRNAs in the context of cancer.
25332145 2014 MTA1--a stress response protein: a master regulator of gene expression and cancer cell behavior.
25332144 2014 MTA family of proteins in DNA damage response: mechanistic insights and potential applications.
25332143 2014 MTA family of proteins in prostate cancer: biology, significance, and therapeutic opportunities.
25319202 2014 Function and regulation of MTA1 and MTA3 in malignancies of the female reproductive system.
25315817 2014 Significance of MTA1 in the molecular characterization of osteosarcoma.
25315816 2014 Identification and characterization of metastasis-associated gene/protein 1 (MTA1).
25301048 2015 Metastasis-associated protein 1 expression in oral squamous cell carcinomas: correlation with metastasis and angiogenesis.
25245523 2014 MTA1 overexpression induces cisplatin resistance in nasopharyngeal carcinoma by promoting cancer stem cells properties.
25205035 2015 MTA1 regulates higher-order chromatin structure and histone H1-chromatin interaction in-vivo.
24970816 2014 The subcellular distribution and function of MTA1 in cancer differentiation.
24920672 2014 Insight into the architecture of the NuRD complex: structure of the RbAp48-MTA1 subcomplex.
24853685 2014 Immunoglobulin G expression in lung cancer and its effects on metastasis.
24424621 2014 Metastasis-associated protein 1 promotes tumor invasion by downregulation of E-cadherin.
24413532 2014 Differential regulation of estrogen receptor ? expression in breast cancer cells by metastasis-associated protein 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24265228 2015 Crosstalk between VEGF and MTA1 signaling pathways contribute to aggressiveness of breast carcinoma.
24214543 2014 Overexpression of MTA1 promotes invasiveness and metastasis of ovarian cancer cells.
24089055 2013 Metastasis-associated protein 1 is an integral component of the circadian molecular machinery.
23941622 2013 MTA1 promotes nasopharyngeal carcinoma growth in vitro and in vivo.
23900262 2013 Nuclear MTA1 overexpression is associated with aggressive prostate cancer, recurrence and metastasis in African Americans.
23866297 2013 Metastasis-associated protein 1 is a novel marker predicting survival and lymph nodes metastasis in cervical cancer.
23831020 2013 Repression of NR4A1 by a chromatin modifier promotes docetaxel resistance in PC-3 human prostate cancer cells.
23791785 2013 Class I HDACs share a common mechanism of regulation by inositol phosphates.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23718732 2013 MTA1 promotes the invasion and migration of non-small cell lung cancer cells by downregulating miR-125b.
23618874 2013 MTA1 contributes to actin cytoskeleton reorganization and metastasis of nasopharyngeal carcinoma by modulating Rho GTPases and Hedgehog signaling.
23592142 2013 Effect of siRNA targeting MTA1 on metastasis malignant phenotype of ovarian cancer A2780 cells.
23371285 2013 MTA-1 expression is associated with metastasis and epithelial to mesenchymal transition in colorectal cancer cells.
23352453 2013 A core chromatin remodeling factor instructs global chromatin signaling through multivalent reading of nucleosome codes.
23343746 2013 Down-regulation of MTA1 protein leads to the inhibition of migration, invasion, and angiogenesis of non-small-cell lung cancer cell line.
23283219 2013 Close association of metastasis-associated protein 1 overexpression with increased angiogenesis and poor survival in patients with histologically node-negative gastric cancer.
23227138 2012 Akt mediates metastasis-associated gene 1 (MTA1) regulating the expression of E-cadherin and promoting the invasiveness of prostate cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
22864797 2012 Prognostic significance of cyclin D1, ?-catenin, and MTA1 in patients with invasive ductal carcinoma of the breast.
22844865 2012 Aberrant expression levels of MTA1 and RECK in nasopharyngeal carcinoma: association with metastasis, recurrence, and prognosis.
22700976 2012 Metastasis-associated protein 1/histone deacetylase 4-nucleosome remodeling and deacetylase complex regulates phosphatase and tensin homolog gene expression and function.
22576802 2012 MTA1 gene silencing inhibits invasion and alters the microRNA expression profile of human lung cancer cells.
22575258 2012 False-positive and false-negative sentinel node findings in 473 breast cancers.
22547301 2013 MTA1: a prognosis indicator of postoperative patients with esophageal carcinoma.
22537306 2012 Nuclear overexpression of metastasis-associated protein 1 correlates significantly with poor survival in nasopharyngeal carcinoma.
22286760 2012 Poly(ADP-ribosyl)ation of p53 induces gene-specific transcriptional repression of MTA1.
22270988 2012 Metastasis-associated protein 1 nuclear expression is closely associated with tumor progression and angiogenesis in patients with esophageal squamous cell cancer.
22270359 2012 Leptin-induced epithelial-mesenchymal transition in breast cancer cells requires ?-catenin activation via Akt/GSK3- and MTA1/Wnt1 protein-dependent pathways.
22253283 2012 Metastasis-associated protein 1/nucleosome remodeling and histone deacetylase complex in cancer.
22176993 2011 [Relationship between MTA1 expression and invasive and metastatic ability of cervical cancer cell].
22139444 2012 microRNA-30c negatively regulates endometrial cancer cells by targeting metastasis-associated gene-1.
22098246 2012 Single nucleotide polymorphisms associated with metastatic tumour antigen 1 overexpression in patients with hepatocellular carcinoma.
22022494 2011 Transient protection from heat-stress induced apoptotic stimulation by metastasis-associated protein 1 in pachytene spermatocytes.
21965678 2011 SUMOylation and SUMO-interacting motif (SIM) of metastasis tumor antigen 1 (MTA1) synergistically regulate its transcriptional repressor function.
21949998 2011 [Expression and significance of MTA1 and RECK gene in nasopharyngeal carcinoma].
21892752 2011 MTA1 expression correlates significantly with cigarette smoke in non-small cell lung cancer.
21837953 2011 [Regulatory effect of MTA1 on the anoikis of human prostate cancer cells].
21835429 2012 Prognostic role of metastasis tumor antigen 1 in patients with ovarian cancer: a clinical study.
21813470 2012 Overexpression of EIF5A2 promotes colorectal carcinoma cell aggressiveness by upregulating MTA1 through C-myc to induce epithelial-mesenchymaltransition.
21725997 2011 Inflammatory response to liver fluke Opisthorchis viverrini in mice depends on host master coregulator MTA1, a marker for parasite-induced cholangiocarcinoma in humans.
21661415 Malignant potential of Barrett's esophagus: special reference to HDAC-1 and MTA-1 expression.
21617866 2011 Expression of histone deacetylase 1 and metastasis-associated protein 1 as prognostic factors in colon cancer.
21595884 2011 ShRNA-mediated gene silencing of MTA1 influenced on protein expression of ER alpha, MMP-9, CyclinD1 and invasiveness, proliferation in breast cancer cell lines MDA-MB-231 and MCF-7 in vitro.
21555589 2011 Bidirectional autoregulatory mechanism of metastasis-associated protein 1-alternative reading frame pathway in oncogenesis.
21448429 2011 Metastasis-associated protein 1 induces VEGF-C and facilitates lymphangiogenesis in colorectal cancer.
21445634 2011 Involvement of HER-2/neu and metastasis-related proteins in the development of ileal neuroendocrine tumors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21336715 2011 Silencing MTA1 by RNAi reverses adhesion, migration and invasiveness of cervical cancer cells (SiHa) via altered expression of p53, and E-cadherin/?-catenin complex.
21290196 2011 Overexpression of metastasis-associated protein 1 is significantly correlated with tumor angiogenesis and poor survival in patients with early-stage non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
21258411 2011 TGF-?1 signaling targets metastasis-associated protein 1, a new effector in epithelial cells.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
21240515 2011 Relationships between metastasis-associated protein (MTA) 1 and lymphatic metastasis in tonsil cancer.
21047798 2011 Insights into association of the NuRD complex with FOG-1 from the crystal structure of an RbAp48·FOG-1 complex.
20935042 2011 Relation between prognosis and expression of metastasis-associated protein 1 in stage I non-small cell lung cancer.
20717904 2011 Targeting prostate cancer angiogenesis through metastasis-associated protein 1 (MTA1).
20710043 2010 Metastasis-associated protein 1 short form stimulates Wnt1 pathway in mammary epithelial and cancer cells.
20697987 2011 Clinical significance of Maspin promoter methylation and loss of its protein expression in invasive ductal breast carcinoma: correlation with VEGF-A and MTA1 expression.
20682799 2010 Metastasis-associated protein 1 and its short form variant stimulates Wnt1 transcription through promoting its derepression from Six3 corepressor.
20661085 2010 Metastasis-associated protein 1 nuclear expression is associated with tumor progression and clinical outcome in patients with non-small cell lung cancer.
20651739 2010 Acetylation-dependent oncogenic activity of metastasis-associated protein 1 co-regulator.
20619094 2010 [Expression of Mta-1 and VEGF and their correlation in the endometrial cancer].
20547755 2010 Differential regulation of HIC1 target genes by CtBP and NuRD, via an acetylation/SUMOylation switch, in quiescent versus proliferating cells.
20427275 2010 Requirement of MTA1 in ATR-mediated DNA damage checkpoint function.
20071335 2010 Revelation of p53-independent function of MTA1 in DNA damage response via modulation of the p21 WAF1-proliferating cell nuclear antigen pathway.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20022949 2010 Stimulation of inducible nitric oxide by hepatitis B virus transactivator protein HBx requires MTA1 coregulator.
19837670 2009 MTA1 coregulator regulates p53 stability and function.
19805145 2009 E3 ubiquitin ligase COP1 regulates the stability and functions of MTA1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19584269 2009 MicroRNA-661, a c/EBPalpha target, inhibits metastatic tumor antigen 1 and regulates its functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19403384 2009 [Expressions of metastatic tumor antigen 1 and hypoxia-inducible-factor l alpha in lung cancer and their clinical significance].
19377441 2009 Immunohistochemical and clinicopathological correlation of the metastasis-associated gene 1 (MTA1) expression in benign and malignant pancreatic endocrine tumors.
19366061 Expression of ezrin and metastatic tumor antigen in osteosarcomas of the jaw.
19363681 2009 The metastasis-associated genes MTA1 and MTA3 are abundantly expressed in human placenta and chorionic carcinoma cells.
18769059 2008 Involvement of metastasis tumor antigen 1 in hepatic regeneration and proliferation.
18719363 2008 The metastasis-associated gene MTA1 is upregulated in advanced ovarian cancer, represses ERbeta, and enhances expression of oncogenic cytokine GRO.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640824 2008 Overexpression of metastasis-associated MTA1 in oral squamous cell carcinomas: correlation with metastasis and invasion.
18451879 2008 Atrophin recruits HDAC1/2 and G9a to modify histone H3K9 and to determine cell fates.
18362831 2008 Expression of hypoxia-inducible factor-1alpha, histone deacetylase 1, and metastasis-associated protein 1 in pancreatic carcinoma: correlation with poor prognosis with possible regulation.
18306220 2008 Metastatic tumor antigen 1 is closely associated with frequent postoperative recurrence and poor survival in patients with hepatocellular carcinoma.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18196870 2007 Expression of the human MTA1 gene in breast cell lines and in breast cancer tissues.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17922035 2008 Heat shock factor 1 represses estrogen-dependent transcription through association with MTA1.
17922032 2008 MTA1-mediated transcriptional repression of BRCA1 tumor suppressor gene.
17868030 2007 RNA interference of metastasis-associated gene 1 inhibits metastasis of B16F10 melanoma cells in a C57BL/6 mouse model.
17671180 2007 Identification of Pax5 as a target of MTA1 in B-cell lymphomas.
17666527 2007 Repression of Six3 by a corepressor regulates rhodopsin expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16969516 2006 Metastasis-associated protein 1 enhances angiogenesis by stabilization of HIF-1alpha.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16855396 2006 Breast cancer-amplified sequence 3, a target of metastasis-associated protein 1, contributes to tamoxifen resistance in premenopausal patients with breast cancer.
16831056 2006 Comprehensive analysis of the expression of the metastasis-associated gene 1 in human neoplastic tissue.
16807247 2006 Solution structure and antiestrogenic activity of the unique C-terminal, NR-box motif-containing region of MTA1s.
16646402 2006 [Correlation between expression of the MTA1 gene and carcinomas of larynx].
16617102 2006 MTA1, a transcriptional activator of breast cancer amplified sequence 3.
16511565 2006 Metastasis-associated protein 1 enhances stability of hypoxia-inducible factor-1alpha protein by recruiting histone deacetylase 1.
16502042 2006 Breast cancer risk associated with genotypic polymorphism of the genes involved in the estrogen-receptor-signaling pathway: a multigenic study on cancer susceptibility.
16244788 2006 Breast tumors that overexpress nuclear metastasis-associated 1 (MTA1) protein have high recurrence risks but enhanced responses to systemic therapies.
16172399 2005 Metastasis-associated protein 1 (MTA1) is an essential downstream effector of the c-MYC oncoprotein.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456747 2004 MBD3L1 is a transcriptional repressor that interacts with methyl-CpG-binding protein 2 (MBD2) and components of the NuRD complex.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15254226 2004 Metastasis-associated protein 1 interacts with NRIF3, an estrogen-inducible nuclear receptor coregulator.
15095300 2004 Expression of the metastasis-associated MTA1 protein and its relationship to deacetylation of the histone H4 in esophageal squamous cell carcinomas.
15077195 2004 Metastatic tumor antigen 1 short form (MTA1s) associates with casein kinase I-gamma2, an estrogen-responsive kinase.
14871807 2004 The role of metastasis-associated protein 1 in prostate cancer progression.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14735193 2004 Expression of MTA1 promotes motility and invasiveness of PANC-1 pancreatic carcinoma cells.
12920132 2003 The metastasis-associated proteins 1 and 2 form distinct protein complexes with histone deacetylase activity.
12684630 The role of MTA1 gene expression in human hepatocellular carcinoma.
12650603 2003 Tumor metastasis-associated human MTA1 gene and its MTA1 protein product: role in epithelial cancer cell invasion, proliferation and nuclear regulation.
12639951 2003 MICoA, a novel metastasis-associated protein 1 (MTA1) interacting protein coactivator, regulates estrogen receptor-alpha transactivation functions.
12527756 2003 MTA1 interacts with MAT1, a cyclin-dependent kinase-activating kinase complex ring finger factor, and regulates estrogen receptor transactivation functions.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12431981 2003 Repression of 92-kDa type IV collagenase expression by MTA1 is mediated through direct interactions with the promoter via a mechanism, which is both dependent on and independent of histone deacetylation.
12167865 2002 A naturally occurring MTA1 variant sequesters oestrogen receptor-alpha in the cytoplasm.
11804687 2002 Expression of the MTA1 mRNA in advanced lung cancer.
11483358 2001 Differential expression and subcellular distribution of the mouse metastasis-associated proteins Mta1 and Mta3.
11474200 2001 Assignment of the human metastasis-associated gene 1 (MTA1) to human chromosome band 14q32.3 by fluorescence in situ hybridization.
11146623 2001 Transcriptional repression of oestrogen receptor by metastasis-associated protein 1 corepressor.
10967548 2000 Tumor metastasis-associated human MTA1 gene: its deduced protein sequence, localization, and association with breast cancer cell proliferation using antisense phosphorothioate oligonucleotides.
10840944 2000 Molecular analysis of a candidate metastasis-associated gene, MTA1: possible interaction with histone deacetylase 1.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
9885572 1998 NURD, a novel complex with both ATP-dependent chromatin-remodeling and histone deacetylase activities.
8083195 1994 A novel candidate metastasis-associated gene, mta1, differentially expressed in highly metastatic mammary adenocarcinoma cell lines. cDNA cloning, expression, and protein analyses.
7607577 1995 Analysis of the complete sequence of the novel metastasis-associated candidate gene, mta1, differentially expressed in mammary adenocarcinoma and breast cancer cell lines.