Property Summary

NCBI Gene PubMed Count 184
PubMed Score 205.07
PubTator Score 197.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.600 1.8e-02
atypical teratoid / rhabdoid tumor 1.900 5.3e-08
autosomal dominant Emery-Dreifuss muscul... 1.086 3.4e-03
ependymoma 1.900 2.1e-02
gastric carcinoma 1.300 1.9e-02
glioblastoma 1.400 1.0e-05
group 3 medulloblastoma 1.100 9.7e-03
juvenile dermatomyositis 1.202 5.5e-10
lung cancer 1.200 3.5e-02
medulloblastoma, large-cell 2.500 2.7e-06
ovarian cancer 1.900 1.5e-06
primitive neuroectodermal tumor 1.100 3.3e-04
psoriasis -1.300 3.2e-08
Rheumatoid arthritis -1.100 2.9e-02

Protein-protein Interaction (8)

Gene RIF (153)

AA Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYK      1 - 70
AGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSY     71 - 140
LEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQI    141 - 210
DQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVL    211 - 280
CRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESK    281 - 350
LKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC    351 - 420
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREIL    421 - 490
RPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVL    491 - 560
SSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPT    561 - 630
KVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP    631 - 700
PPPAPVNDEPIVIED                                                           701 - 715
//

Text Mined References (198)

PMID Year Title