Property Summary

NCBI Gene PubMed Count 8
PubMed Score 35.86
PubTator Score 185.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Kidney Diseases 110 0.0 0.0
Lead Poisoning 5 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.2e-22
Disease Target Count Z-score Confidence
Wernicke-Korsakoff syndrome 10 3.665 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.600 1.2e-22

Gene RIF (6)

AA Sequence

MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP              1 - 62
//

Text Mined References (9)

PMID Year Title