Property Summary

NCBI Gene PubMed Count 65
PubMed Score 191.77
PubTator Score 308.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 1.1e-03
psoriasis -1.700 5.9e-19

Gene RIF (40)

PMID Text
25933064 MT3 may regulate breast cancer cell invasiveness by modulating the expression of MMP3.
25803827 The study implicates the unique C-terminal sequence of MT-3 in the conversion of HK-2 cells to display an enhanced epithelial phenotype.
24859040 MT-capital I, Ukrainiancapital I, Ukrainiancapital I, Ukrainian increases the amount of active ADAM10 in association with furin, PC7 and PKCalpha.
24242700 The presence of MT-3 in the zona glomerulosa of pathological adrenal cortex may imply a role in the pathophysiology of aldosterone-producing tissues.
24222235 Upregulation of MT-3 gene expression can inhibit esophageal cancer cell proliferation and induce apoptosis.
23794209 The experiments indicate that MT3 is an androgen-upregulated gene, and promotes tumorigenesis of prostate carcinoma cells.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
23482768 MT-III expression may have an impact on the pathogenesis of non-small cell lung cancer.
23086305 the molecular mechanism for protection against the neuronal cytotoxicity of Abeta(1-42) with copper ions
22615124 MT-3 modulates the catalytic redox properties of PrP-Cu(II)
21818286 Esophageal adenocarcinomas are characterized by frequent epigenetic silencing of MT3.
20974010 The roles of zinc and metallothionein-3 in autophagy and/or lysosomal function are reviewed.
20646067 MT2 diminishes Transthyretin-Abeta binding, whereas MT3 has the opposite effect
20039155 Metallothionein-III is a specific component of glial cytoplasmic inclusions and is upregulated in multiple system atrophy.
19881214 It plays a role in the detoxification of heavy metals and reactive oxygen species. (review)
19578815 weak in pancreatic serous cystadenomas; increased expressions in adenomocarcinomas; potential prognostic marker
19536566 study of reaction/binding of cisplatin and transplatin with MT-3 and MT-2 initially bound with zinc; study includes kinetics and stoichiometry of the reactions
19490120 Results provide information on the domain-domain interaction at the molecular level, and shed new light on the mechanism of the bioactivity of human neuronal growth inhibitory factor.
19425569 In this study, the binding of Zn(2+), Ca(2+), and Mg(2+) to human Zn(7)MT-3 and its mutant lacking an acidic hexapeptide insert, Zn(7)MT-3(Delta55-60), was investigated and compared with the binding of Zn(7)MT-2.
18782281 metallothionein in decidual cells seems to be responsible for the proper coexistence between decidual cells and activated immune cells that infiltrate both eutopic and ectopic decidua during cesarean section and placental abruption
18757100 the bioactivity of hGIF is mainly related to the essential metal release and its characteristic conformation.
18554677 Metallothionein-III-induced activation of phosphatidylinositol 3-kinase/Akt and extracellular signal-regulated kinase1/2 up-regulates expression and activity of heme oxygenase-1, which provides protection against oxidative damage in dopaminergic cells.
18533104 The structure adopted by the (6)CPCP(9) motif is the determinant factor of the inhibitory bioactivity of hGIF; but residues within the N-terminal fragment may also influence the peptide conformation and contribute to the protein's bioactivity.
18295594 These results suggest that MT-III upregulates VEGF production in brain endothelial cells by a HIF-1alpha-dependent mechanism.
18208603 The goals of this study were to define the expression of the isoforms of MT 1, 2, 3 at both mRNA and protein levels, in normal prostate, benign prostatic hyperplasia (BPH) and malignant PC-3 cells.
18206644 MT-3 is a highly hypoxia-inducible gene in human adipocytes; the protein may protect adipocytes from hypoxic damage
18182399 The level of MT-3 expression in human proximal tubular cells influences transepithelial resistance and cadherin expression but does not the Cd(+2)-induced loss of vectorial active transport.
17712581 The alpha-domain is indispensable and plays an important role in modulating the stability of the metal cluster in the beta-domain by domain-domain interactions, thus influencing the bioactivity of hMT3.
16945328 mutation of MT3 at Glu23 may alter the NO metabolism and/or affect zinc homeostasis in brain, thus altering the neuronal growth inhibitory activity
16546755 Observational study of gene-disease association. (HuGE Navigator)
16351731 MT3 expression is frequently down-regulated in oesophageal squamous cell carcinoma , by DNA methylation, but that this is not a prognostic indicator
16336778 analysis of the epitope of neuronal growth inhibitory factor (GIF)
16087360 The affect the role of MT3 on cell viability, which may explain in part why the comprehensive effect of MT3 on the cells was elusive.
16036436 Observational study of gene-disease association. (HuGE Navigator)
15190073 Metallothionein-III has anticarcinogenic and neuroprotective roles in cells exposed to gamma rays
12539042 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
12538345 Hypermethylation of metallothionein-3 CpG island in gastric carcinoma
12111700 overexpression can influence the growth and chemotherapeutic drug resistance of the PC-3 prostate cancer cell line
12067712 Overexpression of human metallothionein-III prevents hydrogen peroxide-induced oxidative stress in human fibroblasts. "metallothionein-III "
11849386 MT-3 expression is involved in the transport function of a human renal cell line that retains properties of the proximal tubule.

AA Sequence

MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ        1 - 68
//

Text Mined References (65)

PMID Year Title
25933064 2015 Metallothionein-3 Increases Triple-Negative Breast Cancer Cell Invasiveness via Induction of Metalloproteinase Expression.
25803827 2015 Cadherin expression, vectorial active transport, and metallothionein isoform 3 mediated EMT/MET responses in cultured primary and immortalized human proximal tubule cells.
24859040 2014 Metallothionein-III increases ADAM10 activity in association with furin, PC7, and PKC? during non-amyloidogenic processing.
24242700 2014 Metallothionein-3 (MT-3) in the human adrenal cortex and its disorders.
24222235 2013 Effects of metallothionein-3 and metallothionein-1E gene transfection on proliferation, cell cycle, and apoptosis of esophageal cancer cells.
23794209 2013 Metallothionein 3: an androgen-upregulated gene enhances cell invasion and tumorigenesis of prostate carcinoma cells.
23482768 2013 Expression of metallothionein-III in patients with non-small cell lung cancer.
23086305 2013 The molecular mechanism for human metallothionein-3 to protect against the neuronal cytotoxicity of A?(1-42) with Cu ions.
22615124 2012 The catalytic redox activity of prion protein-Cu(II) is controlled by metal exchange with the Zn(II) -thiolate clusters of Zn(7) metallothionein-3.
21818286 2011 Location-specific epigenetic regulation of the metallothionein 3 gene in esophageal adenocarcinomas.
21320589 2011 Redox activity of ?-synuclein-Cu is silenced by Zn?-metallothionein-3.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20974010 2010 Roles of zinc and metallothionein-3 in oxidative stress-induced lysosomal dysfunction, cell death, and autophagy in neurons and astrocytes.
20646067 2010 Human metallothioneins 2 and 3 differentially affect amyloid-beta binding by transthyretin.
20039155 2011 Association of metallothionein-III with oligodendroglial cytoplasmic inclusions in multiple system atrophy.
19881214 2009 [Cilostazol induces metallothionein expression in vascular cells].
19578815 Immunohistochemical localization of metallothionein and p53 protein in pancreatic serous cystadenomas.
19536566 2009 Reaction of human metallothionein-3 with cisplatin and transplatin.
19490120 2009 The structural and biological significance of the EAAEAE insert in the alpha-domain of human neuronal growth inhibitory factor.
19425569 2009 Effects of Zn(2+), Ca(2+), and Mg(2+) on the structure of Zn(7)metallothionein-3: evidence for an additional zinc binding site.
18782281 2008 The increase in metallothionein and ectopic decidual immunoreactivity with respect to the progression of labor at term and the lack of analogical changes in placental abruption.
18757100 2008 Study on structure-property-reactivity-function relationship of human neuronal growth inhibitory factor (hGIF).
18554677 2008 Metallothionein-III protects against 6-hydroxydopamine-induced oxidative stress by increasing expression of heme oxygenase-1 in a PI3K and ERK/Nrf2-dependent manner.
18533104 2008 Incorporation of a glycine within the conserved TCPCP motif of human neuronal growth inhibitory factor significantly reduces its bioactivity.
18295594 2008 Metallothionein-III induces HIF-1alpha-mediated VEGF expression in brain endothelial cells.
18208603 2008 Differential expression of metallothioneins (MTs) 1, 2, and 3 in response to zinc treatment in human prostate normal and malignant cells and tissues.
18206644 2008 PCR arrays identify metallothionein-3 as a highly hypoxia-inducible gene in human adipocytes.
18182399 2008 Cadmium, vectorial active transport, and MT-3-dependent regulation of cadherin expression in human proximal tubular cells.
18157556 2008 The effect of nitric oxide on metal release from metallothionein-3: gradual unfolding of the protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17712581 2007 Effect of alpha-domain substitution on the structure, property and function of human neuronal growth inhibitory factor.
16945328 2006 Mutation at Glu23 eliminates the neuron growth inhibitory activity of human metallothionein-3.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16601975 2006 The role of Thr5 in human neuron growth inhibitory factor.
16546755 2006 Association between metallothionein genes polymorphisms and sporadic amyotrophic lateral sclerosis in a Japanese population.
16387743 2006 The unique N-terminal sequence of metallothionein-3 is required to regulate the choice between apoptotic or necrotic cell death of human proximal tubule cells exposed to Cd+2.
16351731 2005 Metallothionien 3 expression is frequently down-regulated in oesophageal squamous cell carcinoma by DNA methylation.
16336778 2005 Studies on the epitope of neuronal growth inhibitory factor (GIF) with using of the specific antibody.
16087360 2005 Effect of metallothionein on cell viability and its interactions with cadmium and zinc in HEK293 cells.
16036436 2005 Screening the metallothionein III gene in sporadic amyotrophic lateral sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15190073 2004 Metallothionein-III prevents gamma-ray-induced 8-oxoguanine accumulation in normal and hOGG1-depleted cells.
15129022 2004 Expression of metallothionein isoform 3 (MT-3) determines the choice between apoptotic or necrotic cell death in Cd+2-exposed human proximal tubule cells.
12763630 2003 Expression of metallothionein-III induced by hypoxia attenuates hypoxia-induced cell death in vitro.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12538345 2003 Hypermethylation of metallothionein-3 CpG island in gastric carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383939 2002 Protective effect of metallothionein-III on DNA damage in response to reactive oxygen species.
12187490 2002 Expression of metallothionein isoforms in human chorioretinal complex.
12111700 2002 Metallothionein isoform 3 expression inhibits cell growth and increases drug resistance of PC-3 prostate cancer cells.
12072966 2002 A distinct Cu(4)-thiolate cluster of human metallothionein-3 is located in the N-terminal domain.
12067712 2002 Overexpression of human metallothionein-III prevents hydrogen peroxide-induced oxidative stress in human fibroblasts.
12058024 2002 Growth inhibitory factor prevents neurite extension and the death of cortical neurons caused by high oxygen exposure through hydroxyl radical scavenging.
11994011 2002 Brain-specific metallothionein-3 has higher metal-binding capacity than ubiquitous metallothioneins and binds metals noncooperatively.
11226237 2001 Zinc metallothionein imported into liver mitochondria modulates respiration.
10517878 1999 Metallothionein isoform 3 expression in the human prostate and cancer-derived cell lines.
10355541 1999 Expression of MT-3 protein in the human kidney.
9655243 1998 Expression of the gene encoding metallothionein-3 in organs of the reproductive system.
8751715 1996 The functional significance of brain metallothioneins.
8039715 1994 Structures of the human and mouse growth inhibitory factor-encoding genes.
7677777 1995 Modulation of metallothionein-III mRNA content and growth rate of rat C6-glial cells by transfection with human 5-HT1D receptor genes.
2071148 1991 Human gastric intrinsic factor: characterization of cDNA and genomic clones and localization to human chromosome 11.
1873033 1991 The growth inhibitory factor that is deficient in the Alzheimer's disease brain is a 68 amino acid metallothionein-like protein.
1631128 1992 MT-III, a brain-specific member of the metallothionein gene family.
1464312 1992 Molecular cloning of human growth inhibitory factor cDNA and its down-regulation in Alzheimer's disease.