1. Home
  2. Targets
  3. Metallothionein-1X

Tbio Metallothionein-1X

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling (PubMed:23251525).

 Comments

Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.10
PubTator Score 24.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease -1.121 4.3e-02
acute quadriplegic myopathy 1.823 1.4e-05
astrocytoma 1.200 6.6e-15
atypical teratoid / rhabdoid tumor -1.900 6.0e-03
Breast cancer -1.700 1.7e-08
breast carcinoma -1.100 3.3e-05
colon cancer -1.800 3.4e-03
cutaneous lupus erythematosus -1.400 1.3e-02
cystic fibrosis 1.197 5.6e-05
Down syndrome 1.300 3.2e-02
Endometriosis -2.541 1.6e-02
esophageal adenocarcinoma -1.700 1.9e-02
facioscapulohumeral dystrophy -1.800 3.7e-02
glioblastoma 1.500 3.2e-03
group 3 medulloblastoma -2.000 1.4e-04
hereditary spastic paraplegia 1.017 2.6e-02
interstitial cystitis 1.200 3.7e-03
intraductal papillary-mucinous adenoma (... -2.400 2.3e-03
intraductal papillary-mucinous carcinoma... -2.700 5.9e-03
intraductal papillary-mucinous neoplasm ... -3.200 2.2e-03
invasive ductal carcinoma -1.300 9.4e-03
lung adenocarcinoma -1.500 9.6e-05
lung cancer -1.800 1.8e-03
malignant mesothelioma -1.400 3.6e-06
medulloblastoma, large-cell -2.900 1.3e-04
non-small cell lung cancer -1.266 2.3e-07
osteosarcoma 1.904 1.1e-04
ovarian cancer 2.600 5.3e-07
pancreatic cancer -1.200 1.3e-06
primary pancreatic ductal adenocarcinoma -1.186 4.2e-02
primitive neuroectodermal tumor -1.400 4.8e-02
psoriasis -1.400 3.0e-03
ulcerative colitis -2.400 4.1e-06

Synonym

Accession P80297 A8MUC7 MT-1X
Symbols MT1
MT-1l

Gene

MT1X

 UniProt Keyword (10)

 GO Function (2)

 GO Component (3)

 GO Process (5)

 Compartment GO Term (14)

 MGI Phenotype (19)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (7)

Gene RIF (12)

AA Sequence 

MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA               1 - 61
//

Text Mined References (32)

PMID Year Title