Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.87
PubTator Score 45.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.130 2.3e-03
malignant mesothelioma -1.700 2.5e-07
psoriasis -1.100 1.3e-03
osteosarcoma 1.923 1.1e-06
group 3 medulloblastoma -2.300 5.7e-05
cystic fibrosis 1.128 2.9e-04
atypical teratoid/rhabdoid tumor -1.700 1.0e-05
medulloblastoma, large-cell -2.000 9.8e-04
acute quadriplegic myopathy 1.263 8.3e-09
adrenocortical carcinoma -1.186 2.0e-03
primary pancreatic ductal adenocarcinoma -2.075 1.2e-02
non-small cell lung cancer -1.741 3.4e-12
intraductal papillary-mucinous adenoma (... -2.200 9.5e-03
intraductal papillary-mucinous carcinoma... -2.600 2.7e-02
intraductal papillary-mucinous neoplasm ... -3.800 3.7e-03
lung cancer -3.100 3.9e-06
colon cancer -2.100 1.8e-05
active Crohn's disease -1.249 2.6e-02
pancreatic cancer -2.000 9.2e-03
lung adenocarcinoma -1.300 1.1e-04
Endometriosis -2.839 1.4e-02
ulcerative colitis -2.500 5.5e-08
ovarian cancer 1.800 1.8e-04

Gene RIF (18)

PMID Text
25072246 PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation
24782625 MT1M and MT1G promoter methylation may be used as serum biomarkers for noninvasive detection of hepatocellular carcinoma.
24662736 MT1G was down-regulated in renal cell carcinogenesis.
24634414 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
20032811 Results describe MT1G promoter hypermethylation in hepatoblastoma and demonstrate that aberrant methylation is a frequent event in this malignancy.
19639168 MT1G acts as a tumor suppressor gene in hepatocellular carcinoma
19506903 p16INK4A, DAPK1, PTEN and MT1G genes were not frequently methylated in the stage I non-small cell lung cancer in China.
19491193 Promoter methylation and differential gene expression of five markers: COL1A2, NPM2, HSPB6, DDIT4L and MT1G were validated by sequencing of bisulfite-modified DNA and real-time reverse transcriptase PCR, respectively.
19137073 Using a panel of four genes (AHRR, p16INK4a, MT1G, and CLDN3) resulted in sensitivity and specificity of 50% and 68%, respectively and may have utility for early detection of esophageal squamous dysplasia and early ESCC.
18639284 MT1G is hypermethylated in renal cell carcinoma.
15747776 Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Heavy metal binding activity.
15735762 Induction of the hMT1G promoter by VEGF and heavy metals occurs through the utilization of different transcription factors.
12640681 Loss of metallothionein 1G function due to hypermethylation of its promoter leads to athogenesis of papillary thyroid carcinoma
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA              1 - 62
//

Text Mined References (35)

PMID Year Title
25072246 2014 A PU.1 suppressive target gene, metallothionein 1G, inhibits retinoic acid-induced NB4 cell differentiation.
24782625 2014 MT1M and MT1G promoter methylation as biomarkers for hepatocellular carcinoma.
24662736 2015 An epigenetic screen unmasks metallothioneins as putative contributors to renal cell carcinogenesis.
24634414 2014 Metallothionein 1G and zinc sensitize human colorectal cancer cells to chemotherapy.
24098937 2013 Metallothionein 1G functions as a tumor suppressor in thyroid cancer through modulating the PI3K/Akt signaling pathway.
23902976 2013 Promoter methylation profiles between human lung adenocarcinoma multidrug resistant A549/cisplatin (A549/DDP) cells and its progenitor A549 cells.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
20812968 2010 Modulation of metallothionein isoforms is associated with collagen deposition in proliferating keloid fibroblasts in vitro.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
20032811 2010 MT1G hypermethylation: a potential prognostic marker for hepatoblastoma.
19639168 2009 Detection of metallothionein 1G as a methylated tumor suppressor gene in human hepatocellular carcinoma using a novel method of double combination array analysis.
19506903 2009 RASSF1A, APC, ESR1, ABCB1 and HOXC9, but not p16INK4A, DAPK1, PTEN and MT1G genes were frequently methylated in the stage I non-small cell lung cancer in China.
19491193 2009 Genome-wide screen of promoter methylation identifies novel markers in melanoma.
19330122 2003 Low-Dose Cadmium Exposure Reduces Human Prostate Cell Transformation in Culture and Up-Regulates Metallothionein and MT-1G mRNA.
19137073 2008 Promoter methylation in cytology specimens as an early detection marker for esophageal squamous dysplasia and early esophageal squamous cell carcinoma.
18639284 2008 Identification of novel epigenetic markers for clear cell renal cell carcinoma.
18332874 2008 Metallothionein 1G acts as an oncosupressor in papillary thyroid carcinoma.
16827180 2006 Metallothionein 1 isoform gene expression induced by cadmium in human peripheral blood lymphocytes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15735762 2005 Induction of human metallothionein 1G promoter by VEGF and heavy metals: differential involvement of E2F and metal transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12970870 2003 Using yeast two-hybrid system to identify ECRG2 associated proteins and their possible interactions with ECRG2 gene.
12646258 2003 ECRG2, a novel candidate of tumor suppressor gene in the esophageal carcinoma, interacts directly with metallothionein 2A and links to apoptosis.
12640681 2003 Hypermethylation, but not LOH, is associated with the low expression of MT1G and CRABP1 in papillary thyroid carcinoma.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11168427 2001 Metallothionein isogene transcription in red blood cell precursors from human cord blood.
8119276 1994 Induction by zinc of specific metallothionein isoforms in human monocytes.
7559655 1995 Functional analyses of the human metallothionein-IG gene. In vitro and in vivo studies.
6089206 1984 Human metallothionein genes are clustered on chromosome 16.
3403543 1988 Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals.
3023827 1986 Structure, organization, and regulation of human metallothionein IF gene: differential and cell-type-specific expression in response to heavy metals and glucocorticoids.
2444457 1987 Structure and expression of the human metallothionein genes.
2286373 1990 Human metallothionein genes: structure of the functional locus at 16q13.