Property Summary

NCBI Gene PubMed Count 33
PubMed Score 13.96
PubTator Score 8.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis -1.099 5.7e-04
malignant mesothelioma -3.000 3.4e-07
psoriasis -1.100 8.5e-03
osteosarcoma 1.292 9.3e-05
sonic hedgehog group medulloblastoma -1.900 1.4e-05
cystic fibrosis 1.185 1.4e-04
atypical teratoid/rhabdoid tumor -2.100 3.7e-07
medulloblastoma, large-cell -1.800 1.9e-03
acute quadriplegic myopathy 1.840 9.4e-09
adrenocortical carcinoma -1.238 1.7e-02
tuberculosis and treatment for 6 months -1.500 3.9e-04
primary pancreatic ductal adenocarcinoma -2.368 1.8e-03
non-small cell lung cancer -1.661 1.0e-11
intraductal papillary-mucinous adenoma (... -1.900 8.2e-03
intraductal papillary-mucinous carcinoma... -2.300 2.3e-02
intraductal papillary-mucinous neoplasm ... -3.400 4.0e-03
colon cancer -2.200 8.6e-08
lung cancer -2.400 1.1e-04
active Crohn's disease -1.664 2.0e-02
pancreatic cancer -2.200 1.2e-03
invasive ductal carcinoma -1.034 4.7e-02
Endometriosis -2.558 2.0e-02
inflammatory breast cancer -1.400 3.1e-03
lung carcinoma 1.900 2.9e-17
Pick disease 1.200 3.1e-03
mucosa-associated lymphoid tissue lympho... 1.130 3.0e-02
ulcerative colitis -3.000 3.8e-09
ovarian cancer 2.400 6.5e-06
Down syndrome 1.200 2.5e-02

Gene RIF (12)

PMID Text
24440467 we found that metallothionein expression induced by Cd occurred much later, with the expression seen at least 12h or more after the Nrf2-dependent immediate responses were almost completed.
23536959 Aortic protection in diabetes by zinc supplementation is associated with upregulation of both metallothionein and Nrf2 expression.
23332881 Metallothionein may have a role in the control of apoptosis in pleomorphic adenoma.
23064051 findings show 5 MT isoforms were overexpressed in non-small cell lung cancer and overexpression of MT-1F and MT-2A predicted poor outcome; both isoforms may be involved in progression of this cancer type; upregulated MT-1F expression associated with larger primary tumor size and higher grade of malignanacy
22426038 MT1F is a putative tumor suppressor gene in colon carcinogenesis that is downregulated mainly by loss of heterozygosity in colon cancer tissue
21820154 This study identifies for the first time the relevant metallothionein isoforms for colorectal cancer progression.
21409206 Studies provide the mechanistic properties of metal binding for metallothionein metallation.
21128001 MT-1 rs8052394 A allele is associated with oral squamous cell carcinoma.
20812968 MT-1A, -1F, -1G, -1X and -2A isoforms are significantly down-regulated in proliferating keloid fibroblasts.
19251948 Knockdown of MT1F gene increased particular matter(2.5)-induced H2O2 release in alveolar macrophages.
15369632 In the liver cancer tissue, MT1F shows down-regulated expression that supports the inhibited function of MT1F in cancer growth
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD               1 - 61
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24440467 2014 Significance of the rapid increase in GSH levels in the protective response to cadmium exposure through phosphorylated Nrf2 signaling in Jurkat T-cells.
23536959 2013 Zinc protects against diabetes-induced pathogenic changes in the aorta: roles of metallothionein and nuclear factor (erythroid-derived 2)-like 2.
23332881 2013 Immunohistochemical expression of metallothionein in pleomorphic adenoma of minor salivary glands: a role in the control of apoptosis?
23064051 2013 Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
22426038 2012 Downregulation of metallothionein 1F, a putative oncosuppressor, by loss of heterozygosity in colon cancer tissue.
21820154 2012 Metallothionein expression in colorectal cancer: relevance of different isoforms for tumor progression and patient survival.
21409206 2011 The "magic numbers" of metallothionein.
21269460 2011 Initial characterization of the human central proteome.
21128001 2011 Metallothionein-1 genotypes in the risk of oral squamous cell carcinoma.
20812968 2010 Modulation of metallothionein isoforms is associated with collagen deposition in proliferating keloid fibroblasts in vitro.
19251948 2009 Fine ambient particles induce oxidative stress and metal binding genes in human alveolar macrophages.
18391951 2008 Many sequence variants affecting diversity of adult human height.
16827180 2006 Metallothionein 1 isoform gene expression induced by cadmium in human peripheral blood lymphocytes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15369632 2003 The relationship between metallothionein-1F (MT1F) gene and hepatocellular carcinoma.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11693492 2001 Acute exposure to arsenite induces metallothionein isoform-specific gene expression in human proximal tubule cells.
11291768 2001 Significance of metallothionein expression in breast myoepithelial cells.
11168427 2001 Metallothionein isogene transcription in red blood cell precursors from human cord blood.
10774930 2000 Metallothionein isoform gene expression in zinc-treated human peripheral blood lymphocytes.
9831543 1998 Differential expression of human metallothionein isoform I mRNA in human proximal tubule cells exposed to metals.
8619255 1996 Isoform-specific expression of metallothionein mRNA in the developing and adult human kidney.
7762008 1995 Exposure of human proximal tubule cells to cytotoxic levels of CdCl2 induces the additional expression of metallothionein 1A mRNA.
6095291 1984 Duplicated heavy metal control sequences of the mouse metallothionein-I gene.
6089206 1984 Human metallothionein genes are clustered on chromosome 16.
3403543 1988 Structure and expression of the human metallothionein-IG gene. Differential promoter activity of two linked metallothionein-I genes in response to heavy metals.
3023827 1986 Structure, organization, and regulation of human metallothionein IF gene: differential and cell-type-specific expression in response to heavy metals and glucocorticoids.
2581970 1985 Structure and expression of two human metallothionein-I isoform genes and a related pseudogene.
2444457 1987 Structure and expression of the human metallothionein genes.
2286373 1990 Human metallothionein genes: structure of the functional locus at 16q13.