Property Summary

NCBI Gene PubMed Count 29
PubMed Score 40.10
PubTator Score 146.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -6.700 4.5e-10
osteosarcoma 1.280 5.8e-03
sonic hedgehog group medulloblastoma -2.900 3.2e-08
atypical teratoid/rhabdoid tumor -2.700 7.6e-09
medulloblastoma, large-cell -3.200 4.5e-05
acute quadriplegic myopathy 2.238 3.2e-09
adrenocortical carcinoma -1.122 7.2e-03
primary pancreatic ductal adenocarcinoma -1.573 1.8e-02
non-small cell lung cancer -1.935 7.1e-14
intraductal papillary-mucinous adenoma (... -1.300 2.3e-02
intraductal papillary-mucinous carcinoma... -1.800 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.700 7.9e-03
lung cancer -3.600 1.2e-05
colon cancer -1.800 8.9e-06
pancreatic cancer -1.600 1.6e-02
breast carcinoma -1.200 3.5e-05
lung adenocarcinoma -1.800 4.0e-07
Endometriosis -2.148 3.1e-02
inflammatory breast cancer -1.500 4.7e-03
ulcerative colitis -2.000 1.3e-07
ovarian cancer 1.800 7.3e-06
Down syndrome 1.300 1.1e-02
facioscapulohumeral dystrophy -1.900 3.0e-02

Gene RIF (9)

PMID Text
22843066 MT1E can enhance the migration and invasion of human glioma cells by inducing MMP-9 inactivation via the upregulation of NF-kappaB p50.
21358552 Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes.
20848733 MT1E is a potential tumour suppressor gene, whose loss may promote resistance to apoptosis-inducing therapies.
20551211 Increases in MT gene expression and intracellular zinc levels may contribute directly to maintenance of an immune-activated monocyte by mediating an increased resistance to apoptosis during active HIV-1 viremia.
19420986 High frequency of hypermethylation of MT-1E was found in endometrial carcinomas.
18724390 analysis identified genes known to be associated with cell invasion such as versican, and novel ones, including metallothionein 1E (MT1E) and nicotinamide N-methyltransferase (NNMT)
18349110 Observational study of gene-disease association. (HuGE Navigator)
15747776 Eight MT genes were up-regulated after treatment of T-ALL cells with 0.15 and 1.5 microg/mL of metal ores. Heavy metal ion transporter activity.
12539042 Microarray analysis indicates HIV-1 Tat upregulates the interferon-responsive gene expression of many proteins, including Metallothionein, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA               1 - 61
//

Text Mined References (31)

PMID Year Title
22843066 2012 Role of metallothionein 1E in the migration and invasion of human glioma cell lines.
21358552 2011 Profile of adipose tissue gene expression in premenopausal and postmenopausal women: site-specific differences.
20848733 2010 Metallothionein 1E is methylated in malignant melanoma and increases sensitivity to cisplatin-induced apoptosis.
20551211 2010 Increased metallothionein gene expression, zinc, and zinc-dependent resistance to apoptosis in circulating monocytes during HIV viremia.
19420986 2009 Epigenetic alteration of the metallothionein 1E gene in human endometrial carcinomas.
18724390 2008 Overlapping gene expression profiles of cell migration and tumor invasion in human bladder cancer identify metallothionein 1E and nicotinamide N-methyltransferase as novel regulators of cell migration.
18349110 2008 Polymorphisms in metallothionein-1 and -2 genes associated with the risk of type 2 diabetes mellitus and its complications.
17244347 2007 Pathways and genes differentially expressed in the motor cortex of patients with sporadic amyotrophic lateral sclerosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16827180 2006 Metallothionein 1 isoform gene expression induced by cadmium in human peripheral blood lymphocytes.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14555400 2003 Metallothionein isoform 1 and 2 gene expression in a human urothelial cell line (UROtsa) exposed to CdCl2 and NaAsO2.
12556398 2003 Activation of metallothioneins and alpha-crystallin/sHSPs in human lens epithelial cells by specific metals and the metal content of aging clear human lenses.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11693492 2001 Acute exposure to arsenite induces metallothionein isoform-specific gene expression in human proximal tubule cells.
11168427 2001 Metallothionein isogene transcription in red blood cell precursors from human cord blood.
11133866 2001 Identification and spatial analysis of metallothioneins expressed by the adult human lens.
11053642 2000 In vivo gene expression profile analysis of metallothionein in renal cell carcinoma.
10774930 2000 Metallothionein isoform gene expression in zinc-treated human peripheral blood lymphocytes.
8619255 1996 Isoform-specific expression of metallothionein mRNA in the developing and adult human kidney.
8119276 1994 Induction by zinc of specific metallothionein isoforms in human monocytes.
7932184 1994 Interleukin-1 beta-mediated metallothionein induction and cytoprotection against cadmium and cis-diamminedichloroplatinum.
6095291 1984 Duplicated heavy metal control sequences of the mouse metallothionein-I gene.
6089206 1984 Human metallothionein genes are clustered on chromosome 16.
3856101 1985 Metallothionein gene cluster is split by chromosome 16 rearrangements in myelomonocytic leukaemia.
2581970 1985 Structure and expression of two human metallothionein-I isoform genes and a related pseudogene.
2286373 1990 Human metallothionein genes: structure of the functional locus at 16q13.
1779803 1991 Amino acid sequence determination.