Property Summary

Ligand Count 1
NCBI Gene PubMed Count 1
PubMed Score 775.60
PubTator Score 312.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Optic Atrophy, Hereditary, Leber 14 0.0 0.0
Disease Target Count Z-score Confidence
Leigh disease 100 3.628 1.8
Mitochondrial complex I deficiency 46 0.0 5.0
Disease Target Count Z-score Confidence
Lactocele 3 3.722 1.9
Oral candidiasis 10 3.356 1.7
Mitochondrial myopathy 26 3.062 1.5

Expression

Protein-protein Interaction (1)

Gene RIF (52)

AA Sequence

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMIL      1 - 70
LMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPIS     71 - 140
IMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYII    141 - 210
LTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPT    211 - 280
IMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL       281 - 347
//

Text Mined References (18)

PMID Year Title