Property Summary

NCBI Gene PubMed Count 1
PubMed Score 5676.02
PubTator Score 2675.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26626315 These results indicate that miR-151a-5p may participate in the regulation of cellular respiration and ATP production through targeting Cytb.
26566881 Mitochondrial mutation m.15804T>C in the mtCYB gene in a family with fibromyalgia is associated with NLRP3-inflammasome activation.
24103151 The polymorphisms of CYTB as a very useful DNA marker were significantly different between different geographical Uyghur
24102627 This study suggests that, in part, polymorphisms in the MT-ATP6 and MT-CYB genes may contribute to the unexpected fertilization failure.
21506659 Significant elevation of ERalpha and MTCYB transcript levels in premenopausal leiomyomas and its association with ERalpha, -397 CC genotype suggests the mitochondrial-mediated role of estrogen as the promoter of leiomyoma tumorigenesis.
21389643 Data show that homoplasmic G6709A (MT-CO1) and G14804A (MT-CYB) alterations cause amino acid changes in the highly conserved residues.
19758471 Observational study of gene-disease association. (HuGE Navigator)
19570036 Trx2 overexpression modulates the mRNA levels of the COX1 (cytochrome oxidase subunit I) and Cytb (cytochrome b), which are known to be regulated by GR and NF-kappaB.
19569044 cytochrome B gene mutation induces mitochondrial proliferation and prevents apoptosis in human uroepithelial SV-HUC-1 cells.
19563916 The m.15635T>C transition (S297P) was carried by a newborn who presented with a polyvisceral failure.
19503808 CytbI7T has a role in longevity related to caloric restriction
19342687 mitocryptide-2 (MCT-2) and its human homolog hMCT-2 are cryptides that activate neutrophils
19050702 Observational study of gene-disease association. (HuGE Navigator)
18796602 caspase 8-dependent cleavage of mitochondrial Cyt b and translocation of its C-terminal half into the cytoplasm occurred during FAS-induced apoptosis in both chicken and human cells
18709563 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18481423 Observational study of gene-disease association. (HuGE Navigator)
17015183 Observational study of gene-disease association. (HuGE Navigator)
16008558 biochemical and molecular genetic studies of a patient with both muscle and brain involvement and a severe reduction in the activities of both complexes I and III in skeletal muscle due to a novel mutation in the MTCYB gene
14735157 clinical/phenotypic variability of the G15498A mutation in mitochondrial DNA
12686403 In a mitochondrial myopathy patient, a novel stop-codon mutation (G15761A) was found in the mitochondrial DNA (mtDNA)-encoded cytochrome b gene, resulting in loss of the last 41 amino acids of the protein and complex III deficiency
12391595 Observational study of gene-disease association. (HuGE Navigator)
12031626 The other proband had a non-synonymous G15221A mutation in the cytochrome b gene.

AA Sequence

MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHIT      1 - 70
RDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSF     71 - 140
WGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLG    141 - 210
ITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTI    211 - 280
LRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTII    281 - 350
GQVASVLYFTTILILMPTISLIENKMLKWA                                            351 - 380
//

Text Mined References (24)

PMID Year Title
26566881 2016 Mutation in cytochrome b gene of mitochondrial DNA in a family with fibromyalgia is associated with NLRP3-inflammasome activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
12905068 2003 Association of the mitochondrial DNA 15497G/A polymorphism with obesity in a middle-aged and elderly Japanese population.
12022039 2002 Mitochondrial genome diversity of Native Americans supports a single early entry of founder populations into America.
11891837 2002 Septo-optic dysplasia associated with a new mitochondrial cytochrome b mutation.
11601507 2001 Multisystem disorder associated with a missense mutation in the mitochondrial cytochrome b gene.
11553319 2001 Major genomic mitochondrial lineages delineate early human expansions.
11464242 2001 Functional characterization of novel mutations in the human cytochrome b gene.
11130070 2000 Mitochondrial genome variation and the origin of modern humans.
11047755 2000 Mitochondrial encephalomyopathy and complex III deficiency associated with a stop-codon mutation in the cytochrome b gene.
10960495 2000 A missense mutation in the mitochondrial cytochrome b gene in a revisited case with histiocytoid cardiomyopathy.
10508508 1999 Reanalysis and revision of the Cambridge reference sequence for human mitochondrial DNA.
10502593 1999 Exercise intolerance due to mutations in the cytochrome b gene of mitochondrial DNA.
10453733 1999 A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency.
9818877 1998 Missense mutation in the mtDNA cytochrome b gene in a patient with myopathy.
9806551 1998 Somatic mutations of the mitochondrial genome in human colorectal tumours.
8910895 1996 A novel gly290asp mitochondrial cytochrome b mutation linked to a complex III deficiency in progressive exercise intolerance.
7623448 1995 Novel mutations in mitochondrial cytochrome b in fatal post partum cardiomyopathy.
7530363 1995 Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs.
7219534 1981 Sequence and organization of the human mitochondrial genome.
6100559 1984 Serendipitous cloning of a mitochondrial cDNA and its polymorphism.
1757091 1991 Normal variants of human mitochondrial DNA and translation products: the building of a reference data base.
1732158 1992 Mitochondrial DNA complex I and III mutations associated with Leber's hereditary optic neuropathy.