Property Summary

NCBI Gene PubMed Count 1
PubMed Score 857.23
PubTator Score 7265.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26160915 Results find that COA6 associates with COX2 and is crucial for its maturation and complex IV biogenesis. Also, COA6 interacts with the copper chaperone SCO1 which indicates that COA6 is intrinsically involved in the copper delivery process for COX2.
26138249 The sequencing analysis revealed the presence of 17 variants, mostly causing non-synonymous changes in conserved amino acid residues, typically distributed in the MT-CO2 gene of MUTYH-associated polyposis patients (P < 0.0001), who frequently carried the hot spot m.7763G>A variant.
25505242 The interaction of HIV-1 CA with human cellular cytochrome c oxidase II mitochondrial protein (COX2) is identified by yeast two-hybrid screen
24931671 We also detected in 4 asthenospermic patients a double novels mutations, the first was found in COXII gene (m.8021 G/A) that was absent in normospermic infertile men.
24061460 Protein modeling revealed loss of function mutations of ND6 and COX-II proteins in malignant vs benign tumors
23841600 Mutational analysis show a novel MTCO2 mutation 8249G>A pathogenic variation in Tunisian patients with mitochondrial myopathy.
23826975 The presence of a non-synonymous variation in the COII strongly correlated with poor survival in patients with cytogenetically normal acute myeloid leukemia.
22419111 The interaction of HIV-1 CA with human cellular cytochrome c oxidase II mitochondrial protein (COX2) is identified by yeast two-hybrid screen
22241583 Novel COII mutations responsible for maternally inherited nonsyndromic hearing loss
21858117 The interaction of HIV-1 CA with human cellular cytochrome c oxidase II mitochondrial protein (COX2) is identified by yeast two-hybrid screen
21092633 The apoptotic index of pulmonary vascular endothelial cells was negatively correlated with COXII expression in patients with chronic obstructive pulmonary disease.
21069476 COX-2 expression played an essential role in the proliferation and metastasis of tongue cancer.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19840943 CoxII can be phosphorylated by EGFR and c-Src, and EGF stimulation reduces Cox activity and cellular ATP, an event that is dependent in large part on EGFR localized to the mitochondria.
19771519 COX-II is induced in HIV infected apoptotic T-cells.
19758471 Observational study of gene-disease association. (HuGE Navigator)
19336478 SCO2 acts upstream of SCO1, and that it is indispensable for CO II synthesis.
19295170 a fraction of Sco1 physically associates with the cytochrome c oxidase complex in human muscle mitochondria, suggesting a possible direct relationship between CcO and the regulation of cellular copper homeostasis
19066432 Observational study of gene-disease association. (HuGE Navigator)
19050702 Observational study of gene-disease association. (HuGE Navigator)
18509181 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18409190 mitochondrial 12S/MT-RNR1, MT-CO2/COX2, and MT-ATP6 transcripts is significantly decreased in prostate tumor samples
17619138 Observational study of gene-disease association. (HuGE Navigator)
17578348 DNA hypermethylation of the COX-2 gene may be a potential prognostic marker in early stage cervical cancer.
16288875 Mutations in mtDNA-encoded cytochrome c oxidase subunit II genes causing isolated myopathy or severe encephalomyopathy.
15965049 frequency of occurrence of mtDNA with the COII/tRNA(Lys) intergenic 9-bp deletion polymorphism in patients with myoclonic epilepsy with ragged-red fibers or mitochondrial encephalomyopathy syndrome is higher than that of healthy subjects
15931342 Observational study of genetic testing. (HuGE Navigator)
15316498 Observational study of gene-disease association. (HuGE Navigator)
15308583 Observational study of gene-disease association. (HuGE Navigator)
14607829 study points to a role for surfeit 1(SURF1) in promoting the association of cytochrome c oxidase II with the cytochrome c oxidase I.cytochrome c oxidase subunit 4.cytochrome c oxidase subunit 5A subassembly
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12115729 the expression of mitochondria-encoded COXII is HRG-responsive. The levels of ErbB2 expression are decisive for the diverse biological activities of HRG.
12031622 Ageing muscle: clonal expansions of mitochondrial DNA point mutations and deletions cause focal impairment of mitochondrial function.
11849212 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPA      1 - 70
IILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN     71 - 140
RVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV    141 - 210
LELIPLKIFEMGPVFTL                                                         211 - 227
//

Text Mined References (16)

PMID Year Title
26138249 2015 Mitochondrial variants in MT-CO2 and D-loop instability are involved in MUTYH-associated polyposis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
14760490 2004 Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians.
12949126 2003 Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J.
12840039 2003 Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines.
11130070 2000 Mitochondrial genome variation and the origin of modern humans.
10486321 1999 A missense mutation of cytochrome oxidase subunit II causes defective assembly and myopathy.
9806551 1998 Somatic mutations of the mitochondrial genome in human colorectal tumours.
8277847 1993 Mitochondrial COII sequences and modern human origins.
7530363 1995 Recent African origin of modern humans revealed by complete sequences of hominoid mitochondrial DNAs.
7219534 1981 Sequence and organization of the human mitochondrial genome.
2550900 1989 Nucleotide sequence of human mitochondrial cytochrome c oxidase II cDNA.
1757091 1991 Normal variants of human mitochondrial DNA and translation products: the building of a reference data base.
226894 1979 A different genetic code in human mitochondria.