Property Summary

NCBI Gene PubMed Count 113
PubMed Score 374.12
PubTator Score 234.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Wolf-Hirschhorn syndrome 32 4.046 2.0

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 3.300 6.2e-08
posterior fossa group A ependymoma 4.600 2.7e-20
psoriasis -1.100 3.3e-05
glioblastoma multiforme 1.100 1.2e-15
osteosarcoma 2.542 4.4e-04
adrenocortical carcinoma 1.061 1.5e-02
intraductal papillary-mucinous adenoma (... -1.300 9.2e-04
intraductal papillary-mucinous carcinoma... -1.100 5.7e-03
lung cancer 3.400 2.7e-06
fibroadenoma -1.100 2.8e-02
group 4 medulloblastoma -1.400 8.0e-03
invasive ductal carcinoma -2.100 5.1e-03
ductal carcinoma in situ -1.500 6.3e-03
ovarian cancer 1.100 1.5e-02

Gene RIF (101)

PMID Text
26556783 The SNPs rs3821949 and rs12532 in the MSX1 gene were associated with congenital heart diseases in Chinese Han populations.
26505791 TBP attenuates Msx1-mediated glycoprotein hormone alpha transcriptional repression.
26030286 a Japanese family with nonsyndromic tooth agenesis caused by a novel nucleotide substitution in the intronic region between exons 1 and 2 of the MSX1 gene, is reported.
25953455 Results were suggestive of a positive association between MSX1 rs11726039 and non-syndromic cleft lip with or without cleft palate in the South Indian population.
25738424 Methylation changes were enriched in MSX1, CCND2, and DAXX at specific loci within the hippocampus of patients with schizophrenia and bipolar disorder.
25501212 A comprehensive meta-analysis of 4 case-control studies was conducted to explore the association between polymorphisms of Msh homeobox 1 (MSX1) and transforming growth factor-beta1 (TGF-beta1) genes and hypodontia.
25484111 The sequence dependence of local conformation of DNA enables MSX1 glutamine50>lysine to make hydrogen bond with its target nucleotide(s) of DNA.
25101640 MSX1 homeodomain mutations are associated with tooth agenesis.
24914010 a non-stop mutation in MSX1 is responsible for oligodontia
24748298 From a genetically diverse etiology MSX 1 799 G >T gene variant may be a good screening marker for NSCL/P in Raichur patients
24603642 SNPs in the miRNA-binding sites might play important role in development of NSOCs. if confirmed, polymorphisms may be considered as additional markers for evaluation of infants' risk of NSOCs.
24554542 involvement of PAX9, EDA, SPRY2, SPRY4, and WNT10A as risk factors for MLIA. uncovered 3 strong synergistic interactions between MLIA liability and MSX1-TGFA, AXIN2-TGFA, and SPRY2-SPRY4 gene pairs. 1st evidence of sprouty genes in MLIA susceptibility.
24329876 novel nonsense mutation (c.416G>A) in exon 1 of MSX1 from family with oligodontia. produced termination codon in 1st exon and gene product (W139X) truncated at C terminus; entire homeodomain/MH4 absent. W139X MSX1 responsible for tooth agenesis.
24316698 Probably other genes can determine phenotypical patterns of dental agenesis in the families studied, different than the ones described in the mutations of MSX1
24222224 Combined reduction of MSX1 and PAX9 gene dosages increased the risk for oligodontia in Mexican families.
24103583 Polymorphism in the MSX1 gene is associated with tooth agenesis.
23921572 Variations in IRF6, MSX1 and PAX9, as well as genegene interactions, may be associated with nonsyndromic cleft lip with or without palate.
23903689 the CA repeat polymorphism of the MSX1 gene may play a role in risk of Nonsyndromic oral clefts in populations from Southern Brazil
23731659 Findings suggest that identified polymorphisms (rs34165410 and rs34341187) may be responsible for the oligodontia phenotype in this Chinese family
23718693 Significant association was demonstrated between genotypic distribution of SNPs in the MSX1 and PAX9 genes and tooth agenesis type (TAT) in Korean patients with nonsyndromic cleft lip and palate.
23580168 Between MSX1 rs3821949 and nonsyndromic cleft lip with or without cleft palate is positively associated in the Korean population.
23382810 In Msx1;Dlx5;Dlx6 triple mutant mice (TKO), beside the expected ectrodactyly, we also observe the hallmark morphological anomalies of Msx1;Msx2 double mutants suggesting an epistatic role of Dlx5 and Dlx6 over Msx2.
23130753 The present study provides no evidence that MSX1 polymorphisms (rs3775261, rs1042484, rs12532, rs6446693, rs4464513 and rs1907998) play a major role in non-syndromic cleft lip and/or palate
22813217 Findings suggest that the nonsense mutation in MSX1 might have resulted in rapid degradation of the mutated transcript and caused the phenotype of tooth agenesis with cleft lip in the Chinese family.
22591773 The *6C>T polymorphism, when homozygous, may contribute to agenesis of upper lateral incisors.
22455953 The negative control of beta-catenin/DKK1 feedback loop by MSX1 may potentially contribute to excessive stabilization of beta-catenin.
22297032 The novel c.T671C mutation might be the etiological variant of the MSX1 gene responsible for the lack of permanent teeth in the tested family.
21972896 The results showed positive correlation between MSX1 (799 G>T) gene variant and NSCLP patients. MSX1 (799 G>T) gene variants may be a good screening marker for NSCLP.
21866112 In sequencing the MSX1 coding regions in 124 patients with oral cleft, five variants were found, including three known variants (A34G, G110G and P147Q) and two novel variants (M37L and G267A).
21740177 Replication of a mutation previously implicated in other populations suggests a role for the MSX1 A34G variant in the development of CL(P).
21717107 PIAS1 negatively regulates ubiquitination of Msx1 homeoprotein independent of its SUMO ligase activity.
21689018 No significant association was found between NSOC and rs3821949 or rs12532 in MSX1 gene, whereas an association was observed between the P147Q variant and cleft lip with cleft palate in the case-control analysis.
21626677 a cohort of 93 Swedish probands with non-syndromic, isolated oligodontia, mutations were identified in the EDARADD), AXIN2, MSX1, and PAX9 genes
21448236 An MSX1 allele identified in a single Japanese proband with unilateral cleft lip and palate; secondarily is in patients with mild tooth agenesis identified this same MSX1 variant, functioning as a mildly deleterious, moderately penetrant allele.
21387540 results indicate that MSX1 may be associated with the invasion capacity of Wilms tumors
21366807 Msx-1, RANKL suppression and BMP-2 induction were consistent with bisphosphonate-associated osteopetrosis and impaired bone remodelling in BP- and aRANKL-induced ONJ. Msx-1 suppression suggested a possible explanation of exclusivity of ONJ in jaw bone.
21177256 MSX1 and TGF-beta3 are direct targets of FOXE1.
21111400 Common variants located out of the DNA binding domain of the MSX1 gene can be related to tooth agenesis.
20942943 Msx-1 suppression in ONJ-adjacent periodontal tissue suggested a bisphosphonate-related impairment in cellular differentiation that occurred exclusively jaw remodelling
20672350 Observational study of gene-disease association. (HuGE Navigator)
20660504 No mutations in the MSX1 gene were found in individuals with maxillary lateral incisor agenesis.
20638926 The del/del genotype of the c.469+46_56del mutation in the MSX1 gene may be associated with the increased risk of breast cancer in Polish population and may be considered as an early marker in this disease.
20638926 Observational study of gene-disease association. (HuGE Navigator)
20635363 Epigenetic control by imprinting in MSX1 gene is associated with nonsyndromic cleft lip/palate.
20635363 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20620318 Downregulation of Msx1 and Msx2 gene expression during the narrow window of early embryogenesis may cause an omphalocele by disrupting cellular proliferation and differentiation in the developing body wall.
20602873 PAX9 and MSX1 gene mutation can cause different phenotypes of tooth agenesis.
20572854 most significant associations with nonsyndromic cleft lip with or without cleft palate (CL/P) were found for SNPs in MSX1, including several common haplotypes in the MSX1 genes.
20572854 Observational study of gene-disease association. (HuGE Navigator)
20544801 Observational study of gene-disease association. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20506112 Data report expression of both muscle segment homeobox (MSX)1 and MSX2 in the human fetal ovary.
20450679 Observational study of gene-disease association. (HuGE Navigator)
20087401 Several genes, not just MSX1, in the same region may influence risk of oral clefts.
20087401 Observational study of gene-disease association. (HuGE Navigator)
20060342 In both central and peripheral giant cell granulomas of the jaws, MSX1 protein was abundantly expressed by type I multinucleated giant cells and mononucleated stromal cells with vesicular nuclei but type II multinucleated giant cells did not express it.
20004191 YB1/p32 functionally interacts with Msx1 through its N-terminal region and colocalizes with Msx1 at the nuclear periphery
19922584 Mutations in the coding region of the MSX1 gene play little or no role in the development of Parkinson disease.
19922584 Observational study of gene-disease association. (HuGE Navigator)
19816326 Families with an anterior pattern of tooth agenesis msx1 mutations.
19776500 gene polymorphism is associated with hypodontia
19475667 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19346736 sequence of MSX1 gene in 3 unrelated patients with sporadic, non-syndromic oligodontia; homozygotic deletion of 11 nucleotides in the intron near the 5' splicing site in 2 patients was identified; the deletion may decrease expression of MSX1 protein
18932005 Significant interactions were observed between allele 4 homozygosity of the child with maternal smoking (OR 2.7, 95% CI 1.1-6.6) and with smoking by both parents (OR 4.9, 95% CI 1.4-18.0) in nonsyndromic orofacial clefts.
18932005 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18788550 IVS1-2A > G was a novel splicing mutation identified in the MSX-1 gene and it might be responsible for nonsyndromic oligodontia in this family.
18705505 Observational study of gene-disease association. (HuGE Navigator)
18698632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18379900 MSX1 mRNA is expressed in GH- and TSH-producing pituitary adenomas and in normal pituitary glands.
18374898 PCR-SSCP analysis and DNA sequencing revealed a novel missense mutation c.662C>A in a highly conserved homeobox sequence of MSX1 and a known polymorphisms c.347C>G which may be responsible for the oligodontia.
18177186 Observational study of gene-disease association. (HuGE Navigator)
18177186 positive association between CA polymorphism and cleft lip and/or palate in a Colombian group population
18070437 MSX1 gene is associated with nonsyndromic cleft lip and palate.
18070437 Observational study of gene-disease association. (HuGE Navigator)
17693062 Specifically required for osteogenesis in the cranial neural crest lineage within the frontal bone primordium of Msx1 transgenic mice.
17559452 gene mutation contributes to tooth agenesis in Iranian individuals
17557248 muscle segment homeobox 1 (MSX1) microsatellite marker distribution and the relationship between MSX1 gene and the genetic susceptibility of nonsyndromic cleft lip and palate (NSCLP) in Hunan Hans
17557248 Observational study of gene-disease association. (HuGE Navigator)
17326252 Observational study of gene-disease association. (HuGE Navigator)
17326252 results are consistent with evidence from other studies in the US and Chile and confirm the importance of the MSX1 genotype in determining the risk of cleft lip with or without palate and cleft palate in Koreans
16932841 MSX1 with a novel missense mutation is associated with autosomal recessive oligodontia with associated dental anomalies in Pakistani families
16868654 Observational study of gene-disease association. (HuGE Navigator)
16868654 MSX1 mutations are found in 2% of cases of nonsyndromic cleft lip with or without cleft palate (CL/P) and should be considered for genetic counseling implications, but suggest that the P147Q variant is not pathogenic.
16600910 PIAS1 is required for the appropriate localization and retention of Msx1 at the nuclear periphery in myoblast cells.
16327884 Observational study of gene-disease association. (HuGE Navigator)
15705871 The homeodomain of Msx1 functions as a protein-protein interacting motif rather than a DNA-binding domain and is essential for stabilization, nuclear accumulation, and apoptotic function of wild-type p53.
15381719 the contribution of MSX1 in the etiology of non-syndromic cleft lip/palate in the Chilean population
15264286 We have identified a novel MSX1 mutation (559 C --> T, resulting in Gln187Stop) in three individuals of one family
15029481 Individuals with Huntington disease with MSX1 genotype 3/3 tended to have younger age of onset
12974677 genetic role in odontogenesis and tooth development abnormalities
12807959 MSX1 mutations which may contribute to non-syndromic forms of cleft lip and/or cleft palate are found in 2% of cases of clefting.
12733956 positively associated with cleft lip and/or palate with hypodontia outside the cleft region
12652527 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12651933 mutations make a contribution to clefts in South American populations
12490878 might be involved in the genetic control of cuspid malpositions connected with the specific expression of third molar hypodontia
12097313 mutations in MSX1 are responsible for a specific pattern of inherited tooth agenesis.
11754469 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11384957 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11332647 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADH      1 - 70
RKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKP     71 - 140
ERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLS    141 - 210
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQR    211 - 280
AALPVAPVGLYTAHVGYSMYHLT                                                   281 - 303
//

Text Mined References (116)

PMID Year Title
26556783 2015 Characterization of Transcriptional Repressor Gene MSX1 Variations for Possible Associations with Congenital Heart Diseases.
26505791 2015 Msx1 homeodomain transcription factor and TATA-binding protein interact to repress the expression of the glycoprotein hormone ? subunit gene.
26030286 2015 An aberrant splice acceptor site due to a novel intronic nucleotide substitution in MSX1 gene is the cause of congenital tooth agenesis in a Japanese family.
25953455 2015 Evidence of the involvement of the polymorphisms near MSX1 gene in non-syndromic cleft lip with or without cleft palate.
25738424 2015 Circuit- and Diagnosis-Specific DNA Methylation Changes at ?-Aminobutyric Acid-Related Genes in Postmortem Human Hippocampus in Schizophrenia and Bipolar Disorder.
25501212 2014 Association of MSX1 and TGF-?1 genetic polymorphisms with hypodontia: meta-analysis.
25484111 2015 Role of DNA conformation & energetic insights in Msx-1-DNA recognition as revealed by molecular dynamics studies on specific and nonspecific complexes.
25101640 2014 Characterization of novel MSX1 mutations identified in Japanese patients with nonsyndromic tooth agenesis.
24914010 2014 A novel non-stop mutation in MSX1 causing autosomal dominant non-syndromic oligodontia.
24748298 MSX ? gene variant and non-syndromic clefting: association or rejection?
24603642 2014 A miRNA-binding-site SNP of MSX1 is Associated with NSOC Susceptibility.
24554542 2014 Identification of genetic risk factors for maxillary lateral incisor agenesis.
24329876 2014 Novel nonsense mutation in MSX1 in familial nonsyndromic oligodontia: subcellular localization and role of homeodomain/MH4.
24316698 2014 Exclusion of PAX9 and MSX1 mutation in six families affected by tooth agenesis. A genetic study and literature review.
24222224 2013 Mutational analysis of AXIN2, MSX1, and PAX9 in two Mexican oligodontia families.
24103583 2013 MSX1 and PAX9 investigation in monozygotic twins with variable expression of tooth agenesis.
23921572 2013 SNPs and interaction analyses of IRF6, MSX1 and PAX9 genes in patients with non?syndromic cleft lip with or without palate.
23903689 2013 MSX1 gene and nonsyndromic oral clefts in a Southern Brazilian population.
23731659 2013 Clinical and genetic evaluation of a Chinese family with isolated oligodontia.
23718693 2013 Associations between the risk of tooth agenesis and single-nucleotide polymorphisms of MSX1 and PAX9 genes in nonsyndromic cleft patients.
23708191 2013 Genome-wide association study of multiple congenital heart disease phenotypes identifies a susceptibility locus for atrial septal defect at chromosome 4p16.
23580168 2013 Association between MSX1 SNPs and nonsyndromic cleft lip with or without cleft palate in the Korean population.
23382810 2013 BMP-mediated functional cooperation between Dlx5;Dlx6 and Msx1;Msx2 during mammalian limb development.
23130753 2013 MSX1 gene polymorphisms in non-syndromic cleft lip and/or palate.
22813217 2012 Novel nonsense mutation in MSX1 causes tooth agenesis with cleft lip in a Chinese family.
22591773 2012 Polymorphism in the MSX1 gene in a family with upper lateral incisor agenesis.
22455953 2012 DNAJB6 governs a novel regulatory loop determining Wnt/?-catenin signalling activity.
22297032 2012 Novel MSX1 mutation in a family with autosomal-dominant hypodontia of second premolars and third molars.
21972896 2012 Association of MSX1 799?G>T variant with nonsyndromic cleft lip/palate in South Indian adolescent patients.
21866112 2011 Contribution of MSX1 variants to the risk of non-syndromic cleft lip and palate in a Malay population.
21740177 2011 Genetic studies in the Nigerian population implicate an MSX1 mutation in complex oral facial clefting disorders.
21717107 2011 PIAS1 negatively regulates ubiquitination of Msx1 homeoprotein independent of its SUMO ligase activity.
21689018 2011 Association between MSX1 variants and oral clefts in Han Chinese in western China.
21626677 2011 Isolated oligodontia associated with mutations in EDARADD, AXIN2, MSX1, and PAX9 genes.
21448236 2011 Clinical and functional data implicate the Arg(151)Ser variant of MSX1 in familial hypodontia.
21387540 2011 Expression profiling reveals MSX1 and EphB2 expression correlates with the invasion capacity of Wilms tumors.
21366807 2011 Msx-1 is suppressed in bisphosphonate-exposed jaw bone analysis of bone turnover-related cell signalling after bisphosphonate treatment.
21177256 2011 MSX1 and TGF-beta3 are novel target genes functionally regulated by FOXE1.
21111400 2011 PAX9 and MSX1 transcription factor genes in non-syndromic dental agenesis.
20942943 2010 Expression of Msx-1 is suppressed in bisphosphonate associated osteonecrosis related jaw tissue-etiopathology considerations respecting jaw developmental biology-related unique features.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20660504 2010 Mutational analysis of MSX1 and PAX9 genes in Portuguese families with maxillary lateral incisor agenesis.
20638926 2010 The c.469+46_56del mutation in the homeobox MSX1 gene--a novel risk factor in breast cancer?
20635363 2010 Parent-of-origin effects for MSX1 in a Chilean population with nonsyndromic cleft lip/palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20620318 2010 Msx1 and Msx2 gene expression is downregulated in the cadmium-induced omphalocele in the chick model.
20602873 2010 [Correlation between the phenotype and genotype of tooth agenesis patients by tooth agenesis code].
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20544801 2010 Association between genetic variants of reported candidate genes or regions and risk of cleft lip with or without cleft palate in the polish population.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20506112 2010 BMP signaling in the human fetal ovary is developmentally regulated and promotes primordial germ cell apoptosis.
20450679 2010 [Msh homebox-1 polymorphisms and susceptibility to 198 sporadic tooth agenesis: a case-control study].
20087401 2010 Association between genes on chromosome 4p16 and non-syndromic oral clefts in four populations.
20060342 2010 Parathyroid hormone-related peptide (PTHrP), parathyroid hormone/parathyroid hormone-related peptide receptor 1 (PTHR1), and MSX1 protein are expressed in central and peripheral giant cell granulomas of the jaws.
20004191 2010 YB1/p32, a nuclear Y-box binding protein 1, is a novel regulator of myoblast differentiation that interacts with Msx1 homeoprotein.
19922584 2009 Examination of the MSX1 gene in patients with Parkinson's disease.
19816326 2009 Genetics and human malformations.
19776500 2009 Polymorphism in the Msx1 gene associated with hypodontia in a Brazilian family.
19475667 2009 SNCA variants are associated with increased risk for multiple system atrophy.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19389651 2009 Genome-wide association study of electrocardiographic conduction measures in an isolated founder population: Kosrae.
19346736 2009 Mutations in the human homeobox MSX1 gene in the congenital lack of permanent teeth.
18932005 2008 The MSX1 allele 4 homozygous child exposed to smoking at periconception is most sensitive in developing nonsyndromic orofacial clefts.
18788550 2008 [A novel mutation of MSX1 gene in a Chinese pedigree with oligodontia].
18705505 2008 [Association of muscle segment homeobox gene 1 polymorphisms with nonsyndromic cleft lip with or without cleft palate].
18698632 2008 Genetic susceptibilities in the association between maternal exposure to tobacco smoke and the risk of nonsyndromic oral cleft.
18379900 2008 Expression of MSX1 in human normal pituitaries and pituitary adenomas.
18374898 2008 Identification of a novel missense mutation of MSX1 gene in Chinese family with autosomal-dominant oligodontia.
18177186 2007 Association of MSX1 with nonsyndromic cleft lip and palate in a Colombian population.
18070437 2007 [Transmission disequilibrium test for nonsyndromic cleft lip and palate and segment homeobox gene-1 gene].
17693062 Concerted action of Msx1 and Msx2 in regulating cranial neural crest cell differentiation during frontal bone development.
17559452 2007 The role of MSX1 in tooth agenesis in Iranians.
17557248 2007 [Association study on microsatellite polymorphisms of MSX1 gene and nonsyndromic cleft lip and palate].
17326252 2007 MSX1 polymorphism associated with risk of oral cleft in Korea: evidence from case-parent trio and case-control studies.
16932841 2006 A novel missense mutation in MSX1 underlies autosomal recessive oligodontia with associated dental anomalies in Pakistani families.
16868654 2006 MSX1 mutations contribute to nonsyndromic cleft lip in a Thai population.
16678795 2006 Modification of Msx1 by SUMO-1.
16651263 2006 Functional consequences of interactions between Pax9 and Msx1 genes in normal and abnormal tooth development.
16600910 2006 PIAS1 confers DNA-binding specificity on the Msx1 homeoprotein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16327884 2005 Medical sequencing of candidate genes for nonsyndromic cleft lip and palate.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15705871 2005 Homeobox Msx1 interacts with p53 tumor suppressor and inhibits tumor growth by inducing apoptosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381719 2004 Linkage disequilibrium between MSX1 and non-syndromic cleft lip/palate in the Chilean population.
15264286 2004 A novel MSX1 mutation in hypodontia.
15029481 2004 Evidence for a modifier of onset age in Huntington disease linked to the HD gene in 4p16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12974677 2003 Molecular basis of non-syndromic tooth agenesis: mutations of MSX1 and PAX9 reflect their role in patterning human dentition.
12807959 2003 Complete sequencing shows a role for MSX1 in non-syndromic cleft lip and palate.
12733956 2003 Genetic association studies of cleft lip and/or palate with hypodontia outside the cleft region.
12652527 2003 Variants of developmental genes (TGFA, TGFB3, and MSX1) and their associations with orofacial clefts: a case-parent triad analysis.
12651933 2003 MSX1 and TGFB3 contribute to clefting in South America.
12490878 2002 Concomitant occurrence of canine malposition and tooth agenesis: evidence of orofacial genetic fields.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097313 2002 The role of MSX1 in human tooth agenesis.
11754469 2002 Testing candidate genes for non-syndromic oral clefts using a case-parent trio design.
11390985 2001 Endogenous Msx1 antisense transcript: in vivo and in vitro evidences, structure, and potential involvement in skeleton development in mammals.
11384957 2001 Evaluation of two putative susceptibility loci for oral clefts in the Danish population.
11369996 2001 A nonsense mutation in MSX1 causes Witkop syndrome.
11332647 2001 Evidence of a sex-dependent association between the MSX1 locus and nonsyndromic cleft lip with or without cleft palate in the Chilean population.
11115394 2001 Msx3 protein recruits histone deacetylase to down-regulate the Msx1 promoter.
10862767 2000 14-3-3 interacts with regulator of G protein signaling proteins and modulates their activity.
10742093 2000 MSX1 mutation is associated with orofacial clefting and tooth agenesis in humans.
10529415 1999 Msx1 antagonizes the myogenic activity of Pax3 in migrating limb muscle precursors.
10215616 1999 Transcriptional autorepression of Msx1 gene is mediated by interactions of Msx1 protein with a multi-protein transcriptional complex containing TATA-binding protein, Sp1 and cAMP-response-element-binding protein-binding protein (CBP/p300).
9697309 1998 Protein complex formation between Msx1 and Lhx2 homeoproteins is incompatible with DNA binding activity.
9369446 1997 Msx1 is present in thyrotropic cells and binds to a consensus site on the glycoprotein hormone alpha-subunit promoter.
9111364 1997 Heterodimerization of Msx and Dlx homeoproteins results in functional antagonism.
8700832 1996 A role for the Msx-1 homeodomain in transcriptional regulation: residues in the N-terminal arm mediate TATA binding protein interaction and transcriptional repression.
8696335 1996 A human MSX1 homeodomain missense mutation causes selective tooth agenesis.
2565810 1989 Hox-7, a mouse homeobox gene with a novel pattern of expression during embryogenesis.
1973146 1990 Nomenclature for human homeobox genes.
1969845 1990 The human homeobox gene HOX7 maps to chromosome 4p16.1 and may be implicated in Wolf-Hirschhorn syndrome.
1685479 1991 Structure and sequence of the human homeobox gene HOX7.
1284527 1992 Characterization of the human HOX 7 cDNA and identification of polymorphic markers.