Property Summary

NCBI Gene PubMed Count 124
PubMed Score 318.49
PubTator Score 348.33

Knowledge Summary

Patent (42,933)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (109)

PMID Text
26951679 the MST1R variant c.G917A:p.R306H is highly associated with nasopharyngeal carcinoma (odds ratio of 9.0).
26775595 Study identified four novel uniquely spliced RON transcripts in small cell lung carcinoma (SCLC) and Non-SCLC cell lines.
26772202 Results show that under hypoxia, nuclear RON activates non-homologous end joining DNA repair by interacting with Ku70 and DNA-PKcs and confers chemoresistance.
26721331 Aberrant glycosylation of the RON receptor was shown as an alternative mechanism of oncogenic activation.
26189249 RON expression in endometrial adenocarcinoma was significantly higher than that in normal endometrial tissues.
26152593 Activation of RON as an alternate mechanism in the development of CRPC.
25997828 Data demonstrated upregulated RON isoform expression and significant changes in splicing factor expression in primary ovarian cancer suggesting a regulatory interplay of splicing factor and RON alternative splicing pattern in ovarian cancer.
25874493 the prognostic significance of MET is limited in early stage disease. MET+/RON+ patients had higher overall recurrence rates than those with the other expression patterns
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
25220236 SRSF2 promotes exon 11 inclusion of Ron proto-oncogene through targeting exon 11.
25193665 These results support the hypothesis that the alpha-chain of MSPalphabeta mediates RON dimerization.
24954505 Studies demonstrate that DEK overexpression, due in part to Ron receptor activation, drives breast cancer progression through the induction of Wnt/beta-catenin signaling.
24903148 Results pointed to a novel function for RON as a transcriptional regulator that promotes the survival of cancer cells subjected to hypoxia.
24628993 Data shows that MET and RON are regulated by PAX8 in non-small cell lung cancer.
24518495 Stusies indicate that RON receptor tyrosine kinase is overexpressed and activated in pancreatic tumor specimens.
24388747 RON promotes breast cancer metastasis through altered DNA methylation.
24287326 RON expression was dominantly observed in laryngeal SCC tissues relative to adjacent normal mucosa. Knockdown of RON resulted in significantly reduced cell invasion and cell migration in human laryngeal SCC cells.
24189591 Through double-base and single-base substitution analysis of the 2-nt RNA, this study demonstrated that the GA, CC, UG and AC dinucleotides on exon 11, in addition to the wild-type AG sequence, function as enhancers for exon 11 inclusion of the Ron pre-mRNA.
24155930 intron retention in the RON gene was investigated.
23811285 Demonstrate of the important role of RON in mediating lapatinib resistance in breast cancer cells.
23799848 Ron synergises with EGFR to confer certain adverse features in head and neck squamous cell carcinomas.
23745832 The MET(-) RON(-) phenotype retained its prognostic impact after subgroup analysis.
23597200 Data suggest that oncogenic RON160 is frequently expressed in primary invasive ductal, lobular, and lymph node-involved breast cancer tissues; RON160 overexpression is predominantly observed in invasive ductal and lymph node-involved cases.
23558571 Suggest that MET and MST1R are independent prognostic factors in classical classical Hodgkin's lymphoma, and may allow the identification of a subgroup of cHL patients who require more intensive therapy.
23542172 findings identify the pathway of Ron-c-Abl-PCNA as a mechanism of oncogene-induced cell proliferation, with potentially important implications for development of combination therapy of breast cancer
23483216 the function of RON in tumors may be multidimensional, not just as a tumor suppressor or oncogene.
23294341 RON may influence carcinogenesis in a number of systemic malignancies.
23235762 Knockdown of RON inhibited invasive growth & the activation of oncogenic signaling pathways including Akt, MAPK and beta-catenin. RON up-regulation was associated with tumor size, lymphatic metastasis, invasiveness, tumor stage and poor survival.
22993024 study presents two novel splicing variants of RON in the partial splicing events that involve exons 5 and 6; the difference of these two isoforms is the inclusion or skipping of intron 6
22975341 A new splice variant of RON suggests a novel role for the RON receptor in the progression of metastasis in colorectal cancer.
22974584 These results suggest an important role of RON in the tumorigenesis and metastasis of nasopharyngeal carcinoma.
22958871 RON expression is not associated with prognosis or therapeutic responsiveness in resected pancreatic cancer.
22902361 High RON expression is associated with acute myeloid leukemia.
22848655 the structure of RON Sema-PSI domains at 1.85 A resolution
22613539 Elevated RON expression may contribute to the occurrence, progression and metastasis of non-small cell lung cancer(NSCLC), inferring that it could be useful as a new prognostic indicator for patients with NSCLC.
22585712 High RON expression is associated with small and non-small cell lung cancers.
22515290 Findings suggest the involvement of RON expression in the development of breast cancer, and that an autocrine/paracrine loop of RON seems to affect tumor invasiveness.
22095683 tumor promoter induces RON expression via Egr-1, which, in turn, stimulates cell invasiveness in AGS cells
22086736 results suggest cytoplasmic phosphorylated RON is a potential marker for poor prognosis in Esophageal squamous cell carcinomapatients.
21901254 Results indicate that knockdown of RON inhibits AP-1 activity and induces apoptosis and cell cycle arrest through the modulation of Akt/FoxO signaling in human colorectal cancer cells.
21875933 These findings suggest that the MSP/RON signaling pathway may be regulated by hepsin in tissue homeostasis and in disease pathologies, such as in cancer and immune disorders.
21874262 macrophage stimulating 1 receptor is associated with invasive and oncogenic phenotypes such as tumor cell migration, invasion, resistance to apoptosis and cell cycle arrest
21799005 Nrf2 inducer SFN stabilized Nrf2 and inhibited RON expression in carcinoma cells from various tumor types.
21723047 The results suggest that RON signaling seems to play at least some role in the pathogenesis of Merkel cell carcinoma
21659546 The impact of RON on the proliferation of transformed B cells suggests that RON may be a novel therapeutic target for EBV-associated lymphoproliferative diseases.
21543897 Role of RON in gastroesophageal cancer and its role in cooperative signaling with MET in gastroesophageal tissues and cell lines
21212418 Our findings establish that oncogene addiction to MET involves Ron transactivation
21114864 Alterations in the first IPT domain in extracellular region differentially regulate RON mediated tumorigenic activities.
21081472 results suggest that MSP induces uPAR expression via MAPK, AP-1 and NF-kappaB signaling pathways
20800603 Observational study of gene-disease association. (HuGE Navigator)
20689759 A novel connection between the Ron receptor tyrosine kinase and an important mechanism of tamoxifen resistance in breast cancer.
20664977 RON-targeted siRNA could be therapeutically efficacious by inducing cell apoptosis through the modulation of the NF-kappaB and Bcl-2 family in gastric cancer cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596668 TGase-4 expression is intrinsically linked to the activation of RON in prostate cancer cells and that this autoactivation of RON contributes to the increased cell motility in TGase-4 expressing cells.
20498137 Homodimerization of RON, a receptor tyrosine kinase, usually occurs in cells stimulated by a ligand and leads to the downstream activation of signaling pathways in bladder cancer cells.
20434834 Ron overexpression on a Chk2*1100 deletion background accelerates the development of mammary tumors.
20428780 RONDelta85 is an antagonist to the MSP-RON pathway, which has potential for regulating RON/RON160-mediated tumorigenic activities.
20358644 RON signaling results in MAPK-mediated VEGF secretion by pancreatic cancer cells and promotion of microtubule formation.
20103639 Findings indicate that RON signaling mediates cell survival and in vivo resistance to gemcitabine in pancreatic cancer.
20026054 RON expression in MCF-10A breast epithelial cells lead to an alteration of cell-surface hyaluronan compared to the parental cells.
19956854 analysis of how a defined extracellular region of the RON receptor tyrosine kinase promote RON-mediated motile and invasive phenotypes in epithelial cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19838218 Data show that the knockdown of Ron in PC-3 or DU145 cells results in a significant decrease in angiogenic chemokine production and is associated with a decreased activation of NF-kappaB.
19657358 Observational study of gene-disease association. (HuGE Navigator)
19519771 The expression of several oncogenic RON splice variants in malignant gliomas suggests that these could represent candidate targets for treatment with agents inhibiting RON activity
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19307182 RON is a novel molecular target of HIF-1alpha.
19242504 RON is involved in mesangial cell proliferation under both physiological and pathological conditions
19224914 Results demonstrate that Ron plays an essential role in maintaining malignant phenotypes of colon cancer cells through regulating mutant PI3K activity.
19040718 RON expression is significant in gastric carcinoma tissue and corresponding paraneoplastic tissue, but is not expressed in normal gastric mucosa. RON expression in gastric carcinoma tissue was not related to patient survival rates.
18950514 The entire C-terminus is required for RON or RON160-mediated intracellular signaling events leading to various cellular activities.
18836480 RON has 2 alternative SRC-kinase-mediated modes of signaling that can contribute to oncogenic behavior in normal breast epithelial cells: an MSP-dependent increase in cell proliferation & migration and MSP-independent increased cell survival.
18620091 Ron is a critical factor in tumorigenesis.
18606710 study demonstrates that HIV-1 Tat targets the receptor tyrosine kinase recepteur d'origine nantais (RON), which negatively regulates inflammation & HIV transcription, for proteosome degradation
18606710 Tat trans activation domain and the integrity of the kinase domain of RON receptor are required for Tat-mediated degradation of RON
18593918 The regulation of human RON gene expression by nuclear factor-kappaB; a potential therapeutic role for curcumin in blocking RON tyrosine kinase-mediated invasion of carcinoma cells.
18310076 loss of Smad4 contributes to aberrant RON expression and cross-talk of Smad4-independent TGF-beta signaling and the RON pathway promotes an invasive phenotype
18221954 We found that RON was over expressed in bladder cancer but RON over expression was not associated with overall survival or other clinical parameters
18209063 RON represses HIV transcription at multiple transcriptional check points including initiation, elongation and chromatin organization.
18204077 RON activation differentially regulates claudin expression in epithelial cells
18200509 the linkage disequilibrium with these functional MST1R variants implicate this gene as having a possible role in Crohn Disease pathogenesis.
18200509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18165235 a clear link between Sp1-dependent RON tyrosine kinase expression and invasion of breast carcinoma cells.
18073207 Translocation of c-Met to the nucleus depends upon the adaptor protein Gab1 and importin beta1, and formation of Ca(2+) signals in turn depends upon this translocation
18019691 high expression of Ron in the colorectal mucosa of ulcerative colitis patients suggests that this receptor might play roles in the pathophysiological background of this disease
17616662 RON receptor signaling may contribute to pancreatic carcinogenesis
17611409 RONdelta170 is a naturally occurring variant with dominant negative activities and has potential for inhibiting RON-mediated tumorigenic activities in colorectal cancer cells.
17588532 This study reveals for the first time that RON alone is sufficient to induce complete and stabilized EMT in MDCK cells.
17456594 overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer
17395888 These data suggest that high molecular form hyaluronan is broken down by reactive oxygen species to form low-molecular-weight fragments that signal via RHAMM and RON to stimulate beat frequency.
17311308 RON activation induced molecular and cellular alterations consistent with epithelial-mesenchymal (EMT) transition.
16166746 Mst1r tyrosine kinase-domain deficient-mice have decreased survival times, alterations in cytokine and nitric oxide regulation, and an earlier onset of pulmonary pathology compared with control mice during acute lung injury
16166096 altered exon usage in the juxtamembrane domain of mouse and human RON regulates receptor activity and signaling specificity
15929040 The proto-oncogene, c-Cbl, which modulates ubiquitylation of RON, was increased in glia in both multiple sclerosis brains and experimental autoimmune encephalomyelitis spinal cords
15788670 co-expression of RON and MET is associated with aggressive phenotype in node-negative breast cancer patients
15764806 Receptor RON and uts ligand macrophage stimulating protein are involved in the pathophysiology of endometriosis.
15557181 Data suggest that RON initiates signaling pathways that negatively regulate HIV-1 transcription in monocytes/macrophages, and that HIV-1 suppresses RON function by decreasing protein levels in the brain to assure efficient replication.
15378025 altered expression of RON in colon cancer cells is required to maintain tumorigenic phenotypes
15184888 RON receptor can interact with each of the three members of the class B Plexins and control tumor invasive growth.
15001985 persistent RON expression and activation cause the loss of epithelial phenotypes
14597639 the ron-sema domain can suppress the growth of macrophage-stimulating protein-responsive cells in culture
12919677 Data show that macrophage stimulating protein (MSP) and its receptor (Ron) induce phosphorylation of both Ron and alpha6beta4 integrin, and result in activation of alpha3beta1 integrin.
12915129 These data suggest that coexpression of the MET and RON receptors confer a selective advantage to ovarian cancer cells and might promote ovarian cancer progression.
12802274 Ron tyrosine kinase receptor desensitization mediated by c-Cbl and its binding partner Grb2.
12766581 immunostaining and Western blot showed Ron in normal kidney and in all oncocytomas but never in renal cell carcinomas or in the renal carcinoma cell line Caki-1; Ron was expressed in phosphorylated, i.e., active, form
12676986 HYAL2 receptor protein is associated with the RON receptor tyrosine kinase, rendering it functionally silent.
12527888 These data suggest that RON expression is altered in certain primary colon cancers. Abnormal accumulation of RON variants may play a role in the progression of certain colorectal cancers in vivo
12419829 Transgenic mice in which surfactant protein C promoter was used to express human wild-type RON in distal lung epithelial cells developed multiple RON-expressing lung adenomas with distinct morphology & growth pattern which progressed to adenocarcinoma.
12214279 overexpression of human wild-type RON causes the formation of lung tumors with unique biological characteristics in vivo

AA Sequence

MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAV      1 - 70
FVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQ     71 - 140
GRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAAS    141 - 210
FSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRL    211 - 280
ARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVF    281 - 350
VTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT    351 - 420
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFS    421 - 490
LGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPG    491 - 560
SWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSGLVPEGTHQVTVGQSPCRPLPKDSSKLRPVP    561 - 630
RKDFVEEFECELEPLGTQAVGPTNVSLTVTNMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGT    631 - 700
CLTLEGQSLSVGTSRAVLVNGTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDP    701 - 770
VVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG    771 - 840
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTVGGESCQHEFR    841 - 910
GDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLGILLPLLLLVAALATALVFSY    911 - 980
WWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVP    981 - 1050
LLRKESIQLRDLDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRIT   1051 - 1120
EMQQVEAFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGL   1121 - 1190
QVARSMEYLAEQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ   1191 - 1260
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAV   1261 - 1330
RPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT   1331 - 1400
//

Text Mined References (135)

PMID Year Title
26951679 2016 Whole-exome sequencing identifies MST1R as a genetic susceptibility gene in nasopharyngeal carcinoma.
26775595 2016 Novel splicing variants of recepteur d'origine nantais (RON) tyrosine kinase involving exons 15-19 in lung cancer.
26772202 2016 RON Nuclear Translocation under Hypoxia Potentiates Chemoresistance to DNA Double-Strand Break-Inducing Anticancer Drugs.
26721331 2016 Glycomic analysis of gastric carcinoma cells discloses glycans as modulators of RON receptor tyrosine kinase activation in cancer.
26189249 2015 c-Met and RON expression levels in endometrial adenocarcinoma tissue and their relationship with prognosis.
26152593 2015 Recepteur d'origine nantais (RON), more than a kinase: Role in castrate-resistant prostate cancer.
25997828 2015 RON alternative splicing regulation in primary ovarian cancer.
25874493 2015 MET is a predictive factor for late recurrence but not for overall survival of early stage hepatocellular carcinoma.
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25220236 2014 SRSF2 promotes splicing and transcription of exon 11 included isoform in Ron proto-oncogene.
25193665 2014 Structural basis for the binding specificity of human Recepteur d'Origine Nantais (RON) receptor tyrosine kinase to macrophage-stimulating protein.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24954505 2015 The DEK oncogene promotes cellular proliferation through paracrine Wnt signaling in Ron receptor-positive breast cancers.
24903148 2014 Hypoxia promotes nuclear translocation and transcriptional function in the oncogenic tyrosine kinase RON.
24628993 2014 Role of PAX8 in the regulation of MET and RON receptor tyrosine kinases in non-small cell lung cancer.
24518495 2014 The RON receptor tyrosine kinase in pancreatic cancer pathogenesis and its potential implications for future targeted therapies.
24388747 2014 The RON receptor tyrosine kinase promotes metastasis by triggering MBD4-dependent DNA methylation reprogramming.
24287326 2014 RON (recepteur d'origine nantais) expression and its association with tumor progression in laryngeal squamous cell carcinoma.
24189591 2014 A 2-nt RNA enhancer on exon 11 promotes exon 11 inclusion of the Ron proto-oncogene.
24155930 2013 Intron retention in the alternatively spliced region of RON results from weak 3' splice site recognition.
23811285 2013 RON confers lapatinib resistance in HER2-positive breast cancer cells.
23799848 2013 Ron tyrosine kinase receptor synergises with EGFR to confer adverse features in head and neck squamous cell carcinoma.
23745832 2013 Receptor tyrosine kinases MET and RON as prognostic factors in diffuse large B-cell lymphoma patients receiving R-CHOP.
23597200 2013 Oncogenic variant RON160 expression in breast cancer and its potential as a therapeutic target by small molecule tyrosine kinase inhibitor.
23558571 2013 MET and MST1R as prognostic factors for classical Hodgkin's lymphoma.
23542172 2014 The Ron receptor tyrosine kinase activates c-Abl to promote cell proliferation through tyrosine phosphorylation of PCNA in breast cancer.
23483216 2013 Integrative genomic analyses of recepteur d'origine nantais and its prognostic value in cancer.
23294341 2013 Ron and its expanding role in tumor carcinogenesis.
23235762 Expression of RON in colorectal cancer and its relationships with tumor cell behavior and prognosis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22993024 2012 Identification of novel splicing variants from RON proto-oncogene pre-mRNA.
22975341 2012 A novel variant of the RON receptor tyrosine kinase derived from colorectal carcinoma cells which lacks tyrosine phosphorylation but induces cell migration.
22974584 2012 Involvement of recepteur d'origine nantais receptor tyrosine kinase in Epstein-Barr virus-associated nasopharyngeal carcinoma and its metastasis.
22958871 2012 RON is not a prognostic marker for resectable pancreatic cancer.
22902361 2013 The short form of RON is expressed in acute myeloid leukemia and sensitizes leukemic cells to cMET inhibitors.
22848655 2012 Crystal structure of the Sema-PSI extracellular domain of human RON receptor tyrosine kinase.
22613539 2012 Expression of the recepteur d'originenantais receptor tyrosine kinase in non-small cell lung cancer and its clinical significance.
22585712 2012 Differential expression of RON in small and non-small cell lung cancers.
22515290 2012 Expression and mutational status of RON in neoplastic lesions of the breast: analysis of MSP/RON signaling in ductal carcinoma in situ and invasive ductal carcinoma.
22095683 2012 Upregulation of recepteur d'origine nantais tyrosine kinase and cell invasiveness via early growth response-1 in gastric cancer cells.
22087277 2011 Protein characterization of a candidate mechanism SNP for Crohn's disease: the macrophage stimulating protein R689C substitution.
22086736 2012 Prognostic significance of phosphorylated RON in esophageal squamous cell carcinoma.
21901254 2012 Knockdown of RON inhibits AP-1 activity and induces apoptosis and cell cycle arrest through the modulation of Akt/FoxO signaling in human colorectal cancer cells.
21875933 2011 Proteolytic activation of pro-macrophage-stimulating protein by hepsin.
21874262 2011 Small interfering RNA-directed targeting of RON alters invasive and oncogenic phenotypes of human hepatocellular carcinoma cells.
21799005 2011 Novel function of transcription factor Nrf2 as an inhibitor of RON tyrosine kinase receptor-mediated cancer cell invasion.
21784853 2011 Distinct involvement of the Gab1 and Grb2 adaptor proteins in signal transduction by the related receptor tyrosine kinases RON and MET.
21723047 2011 Tyrosine kinase receptor RON and its ligand MSP in Merkel cell carcinoma.
21659546 2011 Requirement for LMP1-induced RON receptor tyrosine kinase in Epstein-Barr virus-mediated B-cell proliferation.
21543897 2011 RON (MST1R) is a novel prognostic marker and therapeutic target for gastroesophageal adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
21212418 2011 Ron kinase transphosphorylation sustains MET oncogene addiction.
21114864 2010 Deletion or insertion in the first immunoglobulin-plexin-transcription (IPT) domain differentially regulates expression and tumorigenic activities of RON receptor Tyrosine Kinase.
21081472 2011 MSP-induced RON activation upregulates uPAR expression and cell invasiveness via MAPK, AP-1 and NF-?B signals in gastric cancer cells.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20726546 2010 The crystal structure of a constitutively active mutant RON kinase suggests an intramolecular autophosphorylation hypothesis.
20689759 2010 Ron receptor tyrosine kinase activation confers resistance to tamoxifen in breast cancer cell lines.
20664977 2010 Small interfering RNA targeting of Recepteur d'Origine Nantais induces apoptosis via modulation of nuclear factor-kappaB and Bcl-2 family in gastric cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596668 2010 The prostate transglutaminase, TGase-4, coordinates with the HGFL/MSP-RON system in stimulating the migration of prostate cancer cells.
20498137 2010 An unusual function of RON receptor tyrosine kinase as a transcriptional regulator in cooperation with EGFR in human cancer cells.
20434834 2010 Chk2*1100delC Acts in synergy with the Ron receptor tyrosine kinase to accelerate mammary tumorigenesis in mice.
20428780 2010 Inhibition of MSP-RON signaling pathway in cancer cells by a novel soluble form of RON comprising the entire sema sequence.
20358644 2010 The RON tyrosine kinase receptor regulates vascular endothelial growth factor production in pancreatic cancer cells.
20103639 2010 Silencing of RON receptor signaling promotes apoptosis and gemcitabine sensitivity in pancreatic cancers.
20026054 2010 RON-expressing MCF-10A breast epithelial cells exhibit alterations of hyaluronan expression, promoting RON-mediated early adhesion events.
19956854 2010 Alterations in a defined extracellular region of the RON receptor tyrosine kinase promote RON-mediated motile and invasive phenotypes in epithelial cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838218 2010 The Ron receptor tyrosine kinase positively regulates angiogenic chemokine production in prostate cancer cells.
19657358 2009 Effect of BSN-MST1 locus on inflammatory bowel disease and multiple sclerosis susceptibility.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19519771 2009 RON receptor tyrosine kinase in human gliomas: expression, function, and identification of a novel soluble splice variant.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19307182 2009 Recepteur d'origine nantais tyrosine kinase is a direct target of hypoxia-inducible factor-1alpha-mediated invasion of breast carcinoma cells.
19242504 2009 Transactivation of RON receptor tyrosine kinase by interaction with PDGF receptor beta during steady-state growth of human mesangial cells.
19224914 2009 Knockdown of Ron kinase inhibits mutant phosphatidylinositol 3-kinase and reduces metastasis in human colon carcinoma.
19040718 2008 Expression of the RON receptor tyrosine kinase and its association with gastric carcinoma versus normal gastric tissues.
18950514 2008 Significance of the entire C-terminus in biological activities mediated by the RON receptor tyrosine kinase and its oncogenic variant RON160.
18836480 2009 The RON receptor tyrosine kinase promotes MSP-independent cell spreading and survival in breast epithelial cells.
18620091 2008 Met-related receptor tyrosine kinase Ron in tumor growth and metastasis.
18606710 2008 HIV-1 Tat mediates degradation of RON receptor tyrosine kinase, a regulator of inflammation.
18593918 2008 Curcumin blocks RON tyrosine kinase-mediated invasion of breast carcinoma cells.
18593464 2008 Novel splice variants derived from the receptor tyrosine kinase superfamily are potential therapeutics for rheumatoid arthritis.
18310076 2008 Smad4-dependent TGF-beta signaling suppresses RON receptor tyrosine kinase-dependent motility and invasion of pancreatic cancer cells.
18221954 2008 Prognostic value of MET, RON and histoprognostic factors for urothelial carcinoma in the upper urinary tract.
18209063 2008 The receptor tyrosine kinase RON represses HIV-1 transcription by targeting RNA polymerase II processivity.
18204077 2008 Activation of RON differentially regulates claudin expression and localization: role of claudin-1 in RON-mediated epithelial cell motility.
18200509 2008 Two-stage candidate gene study of chromosome 3p demonstrates an association between nonsynonymous variants in the MST1R gene and Crohn's disease.
18165235 2008 Regulation of RON tyrosine kinase-mediated invasion of breast cancer cells.
18073207 2008 c-Met must translocate to the nucleus to initiate calcium signals.
18019691 2007 Receptor protein tyrosine kinase Ron is highly expressed in colorectal mucosa of ulcerative colitis patients.
17616662 2007 The RON receptor tyrosine kinase mediates oncogenic phenotypes in pancreatic cancer cells and is increasingly expressed during pancreatic cancer progression.
17611409 2007 Blocking tumorigenic activities of colorectal cancer cells by a splicing RON receptor variant defective in the tyrosine kinase domain.
17588532 2007 Human RON receptor tyrosine kinase induces complete epithelial-to-mesenchymal transition but causes cellular senescence.
17456594 2007 The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans.
17395888 2007 Apical oxidative hyaluronan degradation stimulates airway ciliary beating via RHAMM and RON.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17311308 2007 Tyrosine kinase receptor RON in human pancreatic cancer: expression, function, and validation as a target.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16166746 2006 Gene expression profiles of Mst1r-deficient mice during nickel-induced acute lung injury.
16166096 2005 Altered exon usage in the juxtamembrane domain of mouse and human RON regulates receptor activity and signaling specificity.
15929040 2005 RON-regulated innate immunity is protective in an animal model of multiple sclerosis.
15788670 2005 Prognostic significance of co-expression of RON and MET receptors in node-negative breast cancer patients.
15764806 2005 The macrophage stimulating protein/RON system: a potential novel target for prevention and treatment of endometriosis.
15632155 2005 The C terminus of RON tyrosine kinase plays an autoinhibitory role.
15557181 2004 RON receptor tyrosine kinase, a negative regulator of inflammation, inhibits HIV-1 transcription in monocytes/macrophages and is decreased in brain tissue from patients with AIDS.
15378025 2004 RNA-mediated gene silencing of the RON receptor tyrosine kinase alters oncogenic phenotypes of human colorectal carcinoma cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15184888 2004 Interplay between scatter factor receptors and B plexins controls invasive growth.
15001985 2004 Collaborative activities of macrophage-stimulating protein and transforming growth factor-beta1 in induction of epithelial to mesenchymal transition: roles of the RON receptor tyrosine kinase.
14982882 2004 Tyrosine kinase receptor RON functions downstream of the erythropoietin receptor to induce expansion of erythroid progenitors.
14597639 2004 The soluble sema domain of the RON receptor inhibits macrophage-stimulating protein-induced receptor activation.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12915129 2003 The RON and MET oncogenes are co-expressed in human ovarian carcinomas and cooperate in activating invasiveness.
12802274 2003 c-Cbl is a critical modulator of the Ron tyrosine kinase receptor.
12766581 2003 The Ron proto-oncogene product is a phenotypic marker of renal oncocytoma.
12676986 2003 Hyaluronidase 2 negatively regulates RON receptor tyrosine kinase and mediates transformation of epithelial cells by jaagsiekte sheep retrovirus.
12527888 2003 Altered expression of the RON receptor tyrosine kinase in primary human colorectal adenocarcinomas: generation of different splicing RON variants and their oncogenic potential.
12472665 2002 Macrophage-stimulating protein and RON receptor tyrosine kinase: potential regulators of macrophage inflammatory activities.
12419829 2002 Multiple pulmonary adenomas in the lung of transgenic mice overexpressing the RON receptor tyrosine kinase. Recepteur d'origine nantais.
12214279 2002 Targeted expression of the receptor tyrosine kinase RON in distal lung epithelial cells results in multiple tumor formation: oncogenic potential of RON in vivo.
10871856 2000 Cross-talk between the proto-oncogenes Met and Ron.
10514476 1999 Interaction of macrophage-stimulating protein with its receptor. Residues critical for beta chain binding and evidence for independent alpha chain binding.
10222149 1999 Macrophage stimulating protein-induced epithelial cell adhesion is mediated by a PI3-K-dependent, but FAK-independent mechanism.
9764835 1998 Proteolytic cleavage and activation of pro-macrophage-stimulating protein and upregulation of its receptor in tissue injury.
9045873 1997 Role of macrophage-stimulating protein and its receptor, RON tyrosine kinase, in ciliary motility.
8918464 1996 STK/RON receptor tyrosine kinase mediates both apoptotic and growth signals via the multifunctional docking site conserved among the HGF receptor family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8816464 1996 A splicing variant of the RON transcript induces constitutive tyrosine kinase activity and an invasive phenotype.
8386824 1993 A novel putative receptor protein tyrosine kinase of the met family.
8247543 1993 A survey of protein tyrosine kinase mRNAs expressed in normal human melanocytes.
8062829 1994 RON is a heterodimeric tyrosine kinase receptor activated by the HGF homologue MSP.
7939629 1994 Identification of the ron gene product as the receptor for the human macrophage stimulating protein.
7687741 1993 A novel recognition motif for phosphatidylinositol 3-kinase binding mediates its association with the hepatocyte growth factor/scatter factor receptor.
7488076 1995 Macrophage-stimulating protein activates Ras by both activation and translocation of SOS nucleotide exchange factor.