Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.82
PubTator Score 16.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 74 1 0.0 0.0
Hearing Loss 17 0.0 0.0
Disease Target Count
hearing impairment 199
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.797 1.9
Disease Target Count Z-score Confidence
Lipoma of colon 4 5.443 2.7
Newcastle disease 14 3.046 1.5

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia -1.200 4.5e-02
adrenocortical carcinoma 1.332 1.5e-02
Astrocytoma, Pilocytic 1.300 8.4e-09
Atopic dermatitis -1.100 2.5e-03
atypical teratoid / rhabdoid tumor 1.900 8.2e-05
Breast cancer -2.400 4.1e-09
breast carcinoma -1.500 8.4e-25
cystic fibrosis 1.200 1.9e-02
ductal carcinoma in situ -1.100 8.2e-03
group 3 medulloblastoma -1.300 3.1e-02
intraductal papillary-mucinous adenoma (... -4.400 7.3e-05
intraductal papillary-mucinous carcinoma... -1.200 6.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 1.3e-02
invasive ductal carcinoma -1.500 2.1e-03
lung adenocarcinoma -1.400 1.1e-14
lung carcinoma -1.400 8.0e-13
medulloblastoma, large-cell -2.100 2.6e-03
non-small cell lung cancer -1.602 2.1e-11
osteosarcoma 2.193 3.0e-06
ovarian cancer -4.600 4.6e-09
pancreatic cancer 1.700 1.0e-03
pancreatic carcinoma 1.700 1.0e-03
Polycystic ovary syndrome -1.172 1.6e-02
posterior fossa group A ependymoma 1.100 1.6e-09
primary pancreatic ductal adenocarcinoma 3.054 9.8e-05
psoriasis -1.100 4.6e-05
spina bifida -1.314 4.4e-02
tuberculosis 1.100 2.3e-03

Protein-protein Interaction (5)

Gene RIF (11)

AA Sequence

MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESA      1 - 70
FEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGA     71 - 140
HLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL                      141 - 192
//

Text Mined References (30)

PMID Year Title