Property Summary

NCBI Gene PubMed Count 20
PubMed Score 39.85
PubTator Score 26.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 3.1e-03
intraductal papillary-mucinous adenoma (... -1.600 2.7e-03
intraductal papillary-mucinous carcinoma... -1.300 2.4e-02
osteosarcoma -1.538 7.1e-03
ovarian cancer 1.200 5.6e-04
pancreatic cancer -1.900 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.310 9.5e-03
psoriasis 2.400 2.5e-05
tuberculosis 2.500 2.9e-07

Gene RIF (12)

AA Sequence

MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVS      1 - 70
CGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH                             71 - 116
//

Text Mined References (21)

PMID Year Title