Property Summary

NCBI Gene PubMed Count 62
PubMed Score 88.08
PubTator Score 129.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
inflammatory breast cancer -1.200 2.0e-04
lung adenocarcinoma -1.300 1.6e-06
malignant mesothelioma 1.600 1.5e-06
medulloblastoma, large-cell -1.900 3.8e-06
nephrosclerosis -1.199 1.2e-02
non-small cell lung cancer -1.245 2.0e-19
osteosarcoma -1.234 3.5e-03
ovarian cancer -1.400 6.6e-07
pancreatic ductal adenocarcinoma liver m... -1.313 1.4e-02
psoriasis 1.500 2.3e-04
tuberculosis 1.200 5.2e-08

Gene RIF (46)

AA Sequence

MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF      1 - 70
GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN     71 - 140
HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ    141 - 210
YLSKNPNGYCGLGGTGVSCPVGIKK                                                 211 - 235
//

Text Mined References (66)

PMID Year Title