Property Summary

NCBI Gene PubMed Count 61
PubMed Score 84.72
PubTator Score 129.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.199 1.2e-02
malignant mesothelioma 1.600 1.5e-06
psoriasis 1.500 2.3e-04
osteosarcoma -1.234 3.5e-03
medulloblastoma, large-cell -1.900 3.8e-06
tuberculosis 1.200 5.2e-08
pancreatic ductal adenocarcinoma liver m... -1.313 1.4e-02
non-small cell lung cancer -1.245 2.0e-19
lung adenocarcinoma -1.300 1.6e-06
inflammatory breast cancer -1.200 2.0e-04
ovarian cancer -1.400 6.6e-07

Protein-protein Interaction (1)

Gene RIF (45)

PMID Text
26718410 this study we have identified, for the first time, compounds structurally related to the natural products fusaricidins that markedly activate recombinant bovine and human MsrA and human MsrB.
26117066 The association of MsrA haplotypes with executive functions indicated that MsrA is associated with executive function defects in bipolar I disorder patients.
25341044 ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA.
23988788 Silencing the expression of the main Msr elements-MsrA, MsrB1, or MsrB2 exacerbates sensitivity toward oxidative stress.
23880405 The functional MSRA rs10903323 G/A polymorphism is associated with coronary artery disease development.
23415806 We hypothesize that the activity of MsrA can be employed as a marker for the isolation of stem and progenitor cell subpopulations for cell therapy applications.
23333304 HIV-1 Vif downregulates the expression of methionine sulfoxide reductase A (MSRA) in Vif-expression T cells
23244167 The MSRA rs10903323 G/A variant allele is associated with Rheumatoid Arthritis development, especially among male patients, older patients, C-Reactive Protein-positive patients, and anti-cyclic citrullinated peptide negative patients.
22867795 Mammalian and yeast MSRA reduced free methionine sulfoxide much more efficiently than MSRB.
22657383 The MSRA rs10903323 gene polymorphism may be implicated in the increased risk to develop cardiovascular events, in particular ischaemic heart disease, observed in rheumatoid arthritis patients.
22634633 Data show that glutaredoxin acts as a reductant for methionine sulfoxide reductases A and B (MsrA and MsrB) with or without resolving cysteine.
22438829 The haplotype with the lowest P value showed association with Meconium ileus in an independent sample of 1,335 unrelated cystic fibrosis patients
21679298 The MSRA gene located on chromosome 8 was found to be associated with the phenotype of schizophrenia in Chinese first-episode schizophrenia patients.
21674055 central obesity-associated variants in LYPLAL1, NRXN3, MSRA, and TFAP2B
21079812 Data suggest a critical role for TXNL6 in MsrA repair of essential lens proteins under oxidative stress conditions and that TXNL6 is important for MsrA defense protection against cataract.
20937881 reduction of MsrA levels results in increased cell proliferation and extracellular matrix degradation, and consequently in a more aggressive cellular phenotype in breast cancer cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20703240 Observational study of gene-disease association. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20617525 Our findings indicate that a novel association in the MSRA gene is related to oxidative stress and support the notion of a major role for this process in rheumatoid arthritis.
20421936 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368336 Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A
19913121 Observational study of gene-disease association. (HuGE Navigator)
19844733 protein-specific autoantibody are associated with pulmonary fibrosis and renal vascular damage in systemic sclerosis
19747232 FOXO3a directly activates the human MsrA promoter in a cell culture system, implying that this could be a conserved mechanism of MsrA regulation.
19557161 TFAP2B, LYPLAL1 and MSRA are associated with adiposity and fat distribution.
19557161 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19542914 MSR enzymes are differentially expressed in human skin
19237503 almost absent catalase and methionine sulfoxide reductase A and B protein expression in human gray/white scalp hair shafts in association with a functional loss of methionine sulfoxide repair in the entire gray hair follicle
19085252 This suggests an important role for an MSRA catalytic antioxidant cycle for protection of the cytoplasmic compartment against oxidative damage.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18845237 Retinoic acid regulates transcription of MSRA gene via two distinct promoters via retinoic acid receptors.
18506707 this work points towards MSRA as a novel schizophrenia candidate gene
18506707 Observational study of gene-disease association. (HuGE Navigator)
17943184 Methionine sulfoxide reductases A and B are seriously affected by hydrogen peroxide accumulation in acute vitiligo.
17784942 MSRA gene on chromosome 8p might possess metastasis suppressor activity in HCC.
17601350 Observational study of gene-disease association. (HuGE Navigator)
16480945 showed the expression and function of both sulfoxide reductases together with thioredoxin reductase in the cytosol as well as in the nucleus of epidermal melanocytes which are especially sensitive to reactive oxygen
16257642 MsrA may play an important role in cellular defenses against oxidative stress and in protection against death by limiting the accumulation of oxidative damage to proteins
16162094 The cloning and characterization of the 5' promoter region of human msrA are reported.
15199188 MsrA is present throughout the human lens, where it is likely to defend lens cells and their components against methionine oxidation
14759519 MSRA is down-regulated during cell aging.

AA Sequence

MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF      1 - 70
GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN     71 - 140
HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ    141 - 210
YLSKNPNGYCGLGGTGVSCPVGIKK                                                 211 - 235
//

Text Mined References (65)

PMID Year Title
26718410 2016 Identification of activators of methionine sulfoxide reductases A and B.
26117066 2015 Methionine sulfoxide reductase A (MsrA) associated with bipolar I disorder and executive functions in A Han Chinese population.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25341044 2014 Arrest defective 1 regulates the oxidative stress response in human cells and mice by acetylating methionine sulfoxide reductase A.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
24670271 2014 Association study of common polymorphisms in MSRA, TFAP2B, MC4R, NRXN3, PPARGC1A, TMEM18, SEC16B, HOXB5 and OLFM4 genes with obesity-related traits among Portuguese children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988788 2013 Proteome alteration in oxidative stress-sensitive methionine sulfoxide reductase-silenced HEK293 cells.
23880405 2013 Methionine sulfoxide reductase A rs10903323 G/A polymorphism is associated with increased risk of coronary artery disease in a Chinese population.
23568457 2013 Genetic variants associated with disordered eating.
23415806 2013 Methionine sulfoxide reductase A as a marker for isolating subpopulations of stem and progenitor cells used in regenerative medicine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23286868 Protection against UVB-induced oxidative stress in human skin cells and skin models by methionine sulfoxide reductase A.
23244167 2013 MSRA polymorphism is associated with the risk of rheumatoid arthritis in a Chinese population.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22867795 2012 Analyses of methionine sulfoxide reductase activities towards free and peptidyl methionine sulfoxides.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22657383 2012 Association of the methionine sulfoxide reductase A rs10903323 gene polymorphism with cardiovascular disease in patients with rheumatoid arthritis.
22634633 2012 Glutaredoxin serves as a reductant for methionine sulfoxide reductases with or without resolving cysteine.
22438829 2012 Variation in MSRA modifies risk of neonatal intestinal obstruction in cystic fibrosis.
21679298 2011 A genome-wide association study for quantitative traits in schizophrenia in China.
21674055 2011 Implications of central obesity-related variants in LYPLAL1, NRXN3, MSRA, and TFAP2B on quantitative metabolic traits in adult Danes.
21079812 2010 TXNL6 is a novel oxidative stress-induced reducing system for methionine sulfoxide reductase a repair of ?-crystallin and cytochrome C in the eye lens.
20937881 2010 Methionine sulfoxide reductase A down-regulation in human breast cancer cells results in a more aggressive phenotype.
20888813 2012 Focus on Molecules: methionine sulfoxide reductase A.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20703240 2010 Polymorphisms in NRXN3, TFAP2B, MSRA, LYPLAL1, FTO and MC4R and their effect on visceral fat area in the Japanese population.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20617525 2010 Identification of the oxidative stress-related gene MSRA as a rheumatoid arthritis susceptibility locus by genome-wide pathway analysis.
20452100 2011 Alzheimer disease pathology in cognitively healthy elderly: a genome-wide study.
20421936 2010 Two new Loci for body-weight regulation identified in a joint analysis of genome-wide association studies for early-onset extreme obesity in French and german study groups.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20368336 2010 Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19844733 2010 Autoantibody against one of the antioxidant repair enzymes, methionine sulfoxide reductase A, in systemic sclerosis: association with pulmonary fibrosis and vascular damage.
19747232 2009 Methionine sulfoxide reductase A expression is regulated by the DAF-16/FOXO pathway in Caenorhabditis elegans.
19557161 2009 Genome-wide association scan meta-analysis identifies three Loci influencing adiposity and fat distribution.
19542914 2009 Differential expression of the antioxidant repair enzyme methionine sulfoxide reductase (MSRA and MSRB) in human skin.
19430479 2009 Genome-wide association study of blood pressure and hypertension.
19237503 2009 Senile hair graying: H2O2-mediated oxidative stress affects human hair color by blunting methionine sulfoxide repair.
19085252 2008 Protection of vascular smooth muscle cells by over-expressed methionine sulphoxide reductase A: role of intracellular localization and substrate availability.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18845237 2009 Retinoic acid regulates the human methionine sulfoxide reductase A (MSRA) gene via two distinct promoters.
18506707 2009 Methionine sulfoxide reductase: a novel schizophrenia candidate gene.
17943184 2008 Methionine sulfoxide reductases A and B are deactivated by hydrogen peroxide (H2O2) in the epidermis of patients with vitiligo.
17784942 2007 Identification of MSRA gene on chromosome 8p as a candidate metastasis suppressor for human hepatitis B virus-positive hepatocellular carcinoma.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16480945 2006 Functioning methionine sulfoxide reductases A and B are present in human epidermal melanocytes in the cytosol and in the nucleus.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16364291 2006 Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina.
16257642 2005 Overexpression of MsrA protects WI-38 SV40 human fibroblasts against H2O2-mediated oxidative stress.
16162094 2006 Identification and analysis of the promoter region of the human methionine sulphoxide reductase A gene.
15680232 2005 Heterogeneity and function of mammalian MSRs: enzymes for repair, protection and regulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199188 2004 Methionine sulfoxide reductase A is important for lens cell viability and resistance to oxidative stress.
14759519 2004 The peptide methionine sulfoxide reductases, MsrA and MsrB (hCBS-1), are downregulated during replicative senescence of human WI-38 fibroblasts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693988 2003 Subcellular localization of methionine sulphoxide reductase A (MsrA): evidence for mitochondrial and cytosolic isoforms in rat liver cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039877 2002 Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins.
10452521 1999 Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA).
8622914 1996 Chromosomal localization of the mammalian peptide-methionine sulfoxide reductase gene and its differential expression in various tissues.