Property Summary

NCBI Gene PubMed Count 102
PubMed Score 129.71
PubTator Score 211.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 2.400 4.0e-04
astrocytoma 1.400 2.2e-07
glioblastoma 3.500 4.3e-04
osteosarcoma 2.012 6.7e-03
adrenocortical carcinoma -1.422 1.5e-02
tuberculosis and treatment for 6 months -1.100 3.5e-02
non-small cell lung cancer -2.651 3.4e-22
intraductal papillary-mucinous adenoma (... -1.300 3.2e-02
lung cancer -3.400 4.6e-05
Breast cancer 2.700 2.6e-02
lung adenocarcinoma -1.700 1.8e-07
pediatric high grade glioma 1.500 1.1e-02
pilocytic astrocytoma 1.600 1.4e-04
posterior fossa group A ependymoma 1.100 1.7e-02
subependymal giant cell astrocytoma 3.492 4.9e-02
invasive ductal carcinoma 2.757 7.2e-05
lung carcinoma -4.000 5.9e-32
gastric carcinoma 1.500 4.9e-02
ovarian cancer -2.100 4.6e-06

Protein-protein Interaction (3)

Gene RIF (92)

PMID Text
26892079 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene is not associated with Prostate Cancer Risk.
26056009 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation.
26001293 Findings suggest that CD204+ Mphis might play detrimental protumoral roles and represent the predominant Mphi phenotype in human bladder cancer.
25620088 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma
25186548 The truncating variant Arg293X in the gene encoding SRA-I/II was associated with reduced lung function and with increased risk of COPD among men, as well as among alpha1-antitrypsin MZ and superoxide dismutase-3 E1I1 heterozygotes.
24839953 High CD204 expression is an independent predictor for both overall and disease-free survival in pancreatic ductal adenocarcinoma.
24718459 Heptapeptide XD4 activates the class A scavenger receptor (SR-A) on the glia by increasing the binding of Abeta to SR-A, thereby promoting glial phagocytosis of Abeta oligomer in microglia.
24604828 rs6966 (3' UTR of PPP1R13L, chr 19q13.32, P = 4.55 x 10(-9)) and rs414580 (intron 2 of MSR1, chr 8p22, P = 6.09 x 10(-8)) were significantly associated with ALL.
24498098 There was a significant negative correlation between the number of CD163(+), CD204(+) or CD206(+) alveolar macrophages.
24419414 High CD204 expression is associated with metastasis and recurrence in non-small-cell lung cancer.
24278429 monomeric collagen type I via CD204 induces phospho-Akt expression shifting alveolar macrophages to the profibrotic M2 type. Innate immune responses induced by collagen monomers might perpetuate pulmonary fibrosis.
23915271 Our data suggest that inefficient folding of SR-AI variants with truncated SRCR domain was recognized by the endoplasmic reticulum associated degradation which leads to the immature N- glycosylation and intracellular retention
23717201 MSR1 to be a critical component of a TLR3-mediated pattern recognition receptor response that exerts an antiviral state in both infected and uninfected hepatocytes, thereby limiting the impact of HCV proteins that disrupt IFN signaling in infected cells
23648122 CD204 is a useful marker for TAMs contributing to the angiogenesis.
23334594 The results of this study found that SR-AI/II was highly expressed on the surface of foamy macrophages in MS lesions.
22878280 We identified in a Chinese population a functional polymorphism in SR-A linked to lung cancer risk. In vivo and in vitro studies demonstrated that SR-A may negatively modulate lung cancer growth and angiogenesis by regulating MMP9 production.
22763563 In patients with symptoms of acute coronary syndrome the amount of CD36 and MSR1 mRNA in circulating monocytes, as well as the density of both receptors on the cells surface was significantly higher.
22687273 Through regulating PI3K/Akt and ERK activity, PKCdelta affects SR-A and CD36 expression and foam cell formation.
22470186 This review demonstrated that class A SR and MARCO are major pattern recognition receptors mediating opsonin-independent phagocytosis.
22470185 In this review, we showed that SR-A and MARCO trigger intracellular signaling, modulating pro-inflammatory and microbicidal activities of macrophages.
22429811 Data suggest that pulmonary metastasis is corrected with levels of Geminin, cleaved caspase-3, CD44, E-cadherin, epidermal growth factor receptor, and CD204 in cancer cells within permeated lymphatic vessels.
22282357 Identified a novel peptide antagonist selective for SR-AI which could be a valuable tool in SR-AI targeted imaging of atherosclerotic lesions.
21658363 Interleukin 10 abrogated the oxidized low density lipoprotein-induced SR-A mRNA expression by 50.2+/-3.9% and its protein by 45.6+/-1.9%.
21596859 Msr1 suppresses leukemia stem cells and chronic myeloid leukemia development.
21460221 Pattern recognition scavenger receptor CD204 attenuates Toll-like receptor 4-induced NF-kappaB activation by directly inhibiting ubiquitination of tumor necrosis factor (TNF) receptor-associated factor 6.
21280004 IFNalpha priming up-regulated the expression of SR-A in human monocyte/macrophages, leading to increased lipid uptake and foam cell formation.
21203986 novel property of SR-AI as a complement receptor for iC3b-opsonized bacteria that can elicit cell signaling
21077973 Observational study of gene-disease association. (HuGE Navigator)
20802348 Stromal macrophage expressing CD204 is associated with tumor aggressiveness in lung adenocarcinoma.
20717903 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20414830 CD36 and SR-A play an important role in platelet-induced foam cell formation from CD34(+) progenitor cells
20410100 Observational study of gene-disease association. (HuGE Navigator)
20384632 Decreased infiltration of macrophage scavenger receptor-positive cells in initial negative biopsy specimens is correlated with positive repeat biopsies of the prostate.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20338659 SRA-1 is an endocytic receptor for hepatitis C virus non-structural protein 3 in dendritic cells.
20086112 Our findings corroborate the involvement of ELAC2, MSR1, and RNASEL in the etiology of prostate cancer even in individuals without a family history.
20086112 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20081102 The MSR1 association with COPD susceptibility, COPD-related measures of lung function, and abnormalities of macrophage function may account for significant COPD morbidity.
20081102 Observational study of gene-disease association. (HuGE Navigator)
19914718 These findings reveal a novel mechanistic insight into an interrelationship between SR-A1 and TLR-3/-9 signaling in human cytomegalovirus-exposed monocytes.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911804 Macrophage SR-A is found to recognize exchangeable apolipoproteins (Apo)A-I and ApoE in both lipid-free and lipid-associated form, suggesting the shared amphipathic alpha-helix as a potential recognition motif.
19790077 SR-AI and SR-AII mRNA in rheumatoid arthritis patients' monocytes were 4-6-fold higher than in healthy controls.
19715475 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19261092 the inhibitory activity of liver X receptor alpha, ATP-binding cassette transporter and macrophage scavenger receptor A by LPS may be related to the transformation of human macrophages into foam cells.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19120472 mutations are associated with prostate cancer risk
18922854 human protein S can inhibit the expression and activity of SR-A through Mer RTK in macrophages, suggesting that human protein S is a modulator for macrophage functions in uptaking of modified lipoproteins
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18566991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18503826 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18436282 Our results do not support a role for RNASEL, or MSR1 mutations in advanced Asian-Indian PC
18436282 Observational study of gene-disease association. (HuGE Navigator)
18398045 Observational study of gene-disease association. (HuGE Navigator)
17945237 SR-A gene expression level in the PBMCs specifically increases in patients with acute coronary syndrome, and provides a predictive marker for a reattack of a cardiovascular event.
17903305 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17805225 Observational study of gene-disease association. (HuGE Navigator)
17768178 Observational study of gene-disease association. (HuGE Navigator)
17768178 MSR1 polymorphisms may play a role in prostate cancer etiology in Chinese men.
17709607 SR-A is a novel cell surface receptor for dsRNA, and therefore, SR-A may play a role in antiviral immune responses
17627168 Observational study of gene-disease association. (HuGE Navigator)
17361499 Macrophage Scavenger Receptor-1 (MSR1) were also genotyped in the family-based study. A coding variant (Pro275Ala) was marginally associated with two qualitative airflow obstruction traits (p < or = 0.02).
17237231 Hook3 interacts with a cytoplasmic domain of scavenger receptor A
16750665 PAF enhances its own receptor expression and then increases lipid accumulation by dysregulating LDL receptor regulation and inducing scavenger receptor expression in mesangial cells
16598737 Observational study of gene-disease association. (HuGE Navigator)
16425212 Meta-analysis of gene-disease association. (HuGE Navigator)
16287155 Observational study of gene-disease association. (HuGE Navigator)
16287155 This study is the first to demonstrate further loss of function variants of MSR1 apart from R293X (nonsense mutation).
16144911 Increased expression of macrophage scavenger receptor is associated with high level of serum IL-6 in colon cancer patients.
16114055 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16114055 Single nucleotide polymorphisms associated with hereditary prostate cancer.
15824169 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
15734964 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15714208 Observational study of gene-disease association. (HuGE Navigator)
15556945 reactive oxygen species generated from a protein kinase C-dependent NAD(P)H oxidase pathway plays a role in the high glucose-induced up-regulation of SR-A
15493872 This is the first study that examines the expression of the novel gene SR-A1 in colon cancer progression.
15042613 Mutations in MSR1 gene might play a role in prostate cancer susceptibility, particularly the R293X mutation
14695991 MSR1 is induced in macrophages by oxidative stress and may enteract with reactive oxygen intermediates and may have a function in prostate cancer development.
14614006 Observational study of gene-disease association. (HuGE Navigator)
12958598 results do not support MSR1 as a risk factor for prostate cancer
12839931 Observational study of gene-disease association. (HuGE Navigator)
12839931 Rare mutations of this receptor are associated with increased prostate cancer susceptibility among African-American men.
12819208 there is a critical role for the membrane-proximal amino acids in SR-A trafficking and SR-A-mediated adhesion and internalization requires distinct cytoplasmic domains
12471593 Observational study of gene-disease association. (HuGE Navigator)
12471593 Common sequence variants of the macrophage scavenger receptor 1 gene are associated with prostate cancer risk
12244320 results show that MSR1 may be important in susceptibility to prostate cancer in men of both African American and European descent

AA Sequence

MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGI      1 - 70
VAAQLLKWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEH     71 - 140
FQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQE    141 - 210
EISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGE    211 - 280
KGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFTKV    281 - 350
RLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQAVHKAAHFGQGTGPIWLNEVFCF    351 - 420
GRESSIEECKIRQWGTRACSHSEDAGVTCTL                                           421 - 451
//

Text Mined References (105)

PMID Year Title
26892079 2016 Identifying N-linked glycan moiety and motifs in the cysteine-rich domain critical for N-glycosylation and intracellular trafficking of SR-AI and MARCO.
26225686 2015 The P275A Polymorphism in the Macrophage Scavenger Receptor 1 Gene and Prostate Cancer Risk: a Meta-Analysis.
26056009 2015 miR-29a promotes scavenger receptor A expression by targeting QKI (quaking) during monocyte-macrophage differentiation.
26001293 2015 High CD204+ tumor-infiltrating macrophage density predicts a poor prognosis in patients with urothelial cell carcinoma of the bladder.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25620088 2015 Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25186548 2014 Genetic variations in scavenger and ??-adrenergic receptors and risk of pulmonary disease.
24839953 2014 Coexpression of CD44-positive/CD133-positive cancer stem cells and CD204-positive tumor-associated macrophages is a predictor of survival in pancreatic ductal adenocarcinoma.
24718459 2014 Activated scavenger receptor A promotes glial internalization of a?.
24604828 2014 Focused screening of a panel of cancer-related genetic polymorphisms reveals new susceptibility loci for pediatric acute lymphoblastic leukemia.
24498098 2014 Overexpression of CD163, CD204 and CD206 on alveolar macrophages in the lungs of patients with severe chronic obstructive pulmonary disease.
24419414 2014 Circulating CD14+CD204+ cells predict postoperative recurrence in non-small-cell lung cancer patients.
24278429 2013 Lung collagens perpetuate pulmonary fibrosis via CD204 and M2 macrophage activation.
23915271 2013 Cysteine-rich domain of scavenger receptor AI modulates the efficacy of surface targeting and mediates oligomeric A? internalization.
23717201 2013 Class A scavenger receptor 1 (MSR1) restricts hepatitis C virus replication by mediating toll-like receptor 3 recognition of viral RNAs produced in neighboring cells.
23648122 2013 Tumor associated macrophage expressing CD204 is associated with tumor aggressiveness of esophageal squamous cell carcinoma.
23334594 2013 Selective upregulation of scavenger receptors in and around demyelinating areas in multiple sclerosis.
22878280 2012 Class A scavenger receptor deficiency exacerbates lung tumorigenesis by cultivating a procarcinogenic microenvironment in humans and mice.
22763563 2012 Highly upregulated expression of CD36 and MSR1 in circulating monocytes of patients with acute coronary syndromes.
22687273 2012 PKC? signalling regulates SR-A and CD36 expression and foam cell formation.
22470186 2012 [The role of the class A scavenger receptors, SR-A and MARCO, in the immune system. Part 2. Contribution to recognition and phagocytosis of pathogens as well as induction of immune response].
22470185 2012 [The role of the class A scavenger receptors, SR-A and MARCO, in the immune system. Part 1. The structure of receptors, their ligand binding repertoires and ability to initiate intracellular signaling].
22429811 2012 Morphophenotypic characteristics of intralymphatic cancer and stromal cells susceptible to lymphogenic metastasis.
22282357 2012 Design and validation of a specific scavenger receptor class AI binding peptide for targeting the inflammatory atherosclerotic plaque.
21791690 2011 Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma.
21658363 2011 Interleukin-10 down-regulates oxLDL induced expression of scavenger receptor A and Bak-1 in macrophages derived from THP-1 cells.
21596859 2011 A tumor suppressor function of the Msr1 gene in leukemia stem cells of chronic myeloid leukemia.
21460221 2011 Pattern recognition scavenger receptor CD204 attenuates Toll-like receptor 4-induced NF-kappaB activation by directly inhibiting ubiquitination of tumor necrosis factor (TNF) receptor-associated factor 6.
21280004 2011 Interferon-? priming promotes lipid uptake and macrophage-derived foam cell formation: a novel link between interferon-? and atherosclerosis in lupus.
21203986 2010 The class A macrophage scavenger receptor type I (SR-AI) recognizes complement iC3b and mediates NF-?B activation.
21077973 2011 Scavenger receptor AI/II truncation, lung function and COPD: a large population-based study.
20802348 2010 Stromal macrophage expressing CD204 is associated with tumor aggressiveness in lung adenocarcinoma.
20717903 2011 Evidence for an association between prostate cancer and chromosome 8q24 and 10q11 genetic variants in African American men: the Flint Men's Health Study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20414830 2010 CD36 and macrophage scavenger receptor a modulate foam cell formation via inhibition of lipid-laden platelet phagocytosis.
20410100 2010 Genetic variation in APOJ, LPL, and TNFRSF10B affects plasma fatty acid distribution in Alaskan Eskimos.
20384632 2010 Decreased infiltration of macrophage scavenger receptor-positive cells in initial negative biopsy specimens is correlated with positive repeat biopsies of the prostate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20338659 2010 The scavenger receptors SRA-1 and SREC-I cooperate with TLR2 in the recognition of the hepatitis C virus non-structural protein 3 by dendritic cells.
20086112 2010 Single and multivariate associations of MSR1, ELAC2, and RNASEL with prostate cancer in an ethnic diverse cohort of men.
20081102 2010 COPD is associated with a macrophage scavenger receptor-1 gene sequence variation.
19914718 2010 Scavenger receptor A1 is required for sensing HCMV by endosomal TLR-3/-9 in monocytic THP-1 cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911804 2009 Macrophage scavenger receptor A mediates adhesion to apolipoproteins A-I and E.
19790077 2009 Scavenger receptor class A type I/II determines matrix metalloproteinase-mediated cartilage destruction and chondrocyte death in antigen-induced arthritis.
19715475 2009 Increased risk for atherosclerosis of various macrophage scavenger receptor 1 alleles.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19261092 2009 Expression of liver X receptor alpha and lipid metabolism in granulocyte-macrophage colony-stimulating factor-induced human monocyte-derived macrophage.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19120472 2009 Conserved domains of the class A scavenger receptors: evolution and function.
18922854 2009 Human protein S inhibits the uptake of AcLDL and expression of SR-A through Mer receptor tyrosine kinase in human macrophages.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18566991 2008 Joint effects of inflammation and androgen metabolism on prostate cancer severity.
18503826 2008 A multigenic approach to evaluating prostate cancer risk in a systematic replication study.
18436282 2008 Analysis of the RNASEL/HPC1, and macrophage scavenger receptor 1 in Asian-Indian advanced prostate cancer.
18398045 2008 Association between genetic polymorphisms of macrophage scavenger receptor 1 gene and risk of prostate cancer in the health professionals follow-up study.
17945237 2008 Class A macrophage scavenger receptor gene expression levels in peripheral blood mononuclear cells specifically increase in patients with acute coronary syndrome.
17903305 2007 A genome-wide association study of breast and prostate cancer in the NHLBI's Framingham Heart Study.
17805225 2008 Identification of a chromosome 8p locus for early-onset coronary heart disease in a French Canadian population.
17768178 2007 MSR1 variants and the risks of prostate cancer and benign prostatic hyperplasia: a population-based study in China.
17709607 2008 Scavenger receptor class-A is a novel cell surface receptor for double-stranded RNA.
17627168 2007 DNA variation in MSR1, RNASEL and E-cadherin genes and prostate cancer in Poland.
17361499 2006 Genetic linkage and association analysis of COPD-related traits on chromosome 8p.
17237231 2007 The microtubule-binding protein Hook3 interacts with a cytoplasmic domain of scavenger receptor A.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16750665 2006 Platelet-activating factor (PAF) increase intracellular lipid accumulation by increasing both LDL and scavenger receptors in human mesangial cells.
16598737 2006 Mutation screening and association study of the candidate prostate cancer susceptibility genes MSR1, PTEN, and KLF6.
16425212 2006 Meta-analysis of association of rare mutations and common sequence variants in the MSR1 gene and prostate cancer risk.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16287155 2006 Germline mutations of the MSR1 gene in prostate cancer families from Germany.
16144911 2005 Enhanced production of interleukin 6 in peripheral blood monocytes stimulated with mucins secreted into the bloodstream.
16114055 2006 Association of hereditary prostate cancer gene polymorphic variants with sporadic aggressive prostate carcinoma.
15824169 2005 Association of susceptibility alleles in ELAC2/HPC2, RNASEL/HPC1, and MSR1 with prostate cancer severity in European American and African American men.
15734964 2005 Macrophage scavenger receptor 1 999C>T (R293X) mutation and risk of prostate cancer.
15714208 2005 Mutation screening and association study of RNASEL as a prostate cancer susceptibility gene.
15556945 2005 Expression of class A scavenger receptor is enhanced by high glucose in vitro and under diabetic conditions in vivo: one mechanism for an increased rate of atherosclerosis in diabetes.
15493872 2004 SR-A1, a member of the human pre-mRNA splicing factor family, and its expression in colon cancer progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15042613 2004 Analysis of the macrophage scavenger receptor 1 gene in Swedish hereditary and sporadic prostate cancer.
14759258 2004 An unappreciated role for RNA surveillance.
14695991 2004 Mutational analysis of susceptibility genes RNASEL/HPC1, ELAC2/HPC2, and MSR1 in sporadic prostate cancer.
14614006 2003 Germ-line alterations in MSR1 gene and prostate cancer risk.
12958598 2003 No association of germline alteration of MSR1 with prostate cancer risk.
12839931 2003 Germ-line mutations of the macrophage scavenger receptor 1 gene: association with prostate cancer risk in African-American men.
12819208 2003 Class A scavenger receptor-mediated adhesion and internalization require distinct cytoplasmic domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471593 2003 Common sequence variants of the macrophage scavenger receptor 1 gene are associated with prostate cancer risk.
12376530 2002 Scavenger receptors class A-I/II and CD36 are the principal receptors responsible for the uptake of modified low density lipoprotein leading to lipid loading in macrophages.
12244320 2002 Germline mutations and sequence variants of the macrophage scavenger receptor 1 gene are associated with prostate cancer risk.
11785981 2002 HSP90, HSP70, and GAPDH directly interact with the cytoplasmic domain of macrophage scavenger receptors.
10381284 1999 Alpha-tocopherol down-regulates scavenger receptor activity in macrophages.
9548586 1998 A naturally occurring isoform of the human macrophage scavenger receptor (SR-A) gene generated by alternative splicing blocks modified LDL uptake.
9422792 1998 Ligand binding to macrophage scavenger receptor-A induces urokinase-type plasminogen activator expression by a protein kinase-dependent signaling pathway.
8900177 1996 Structures of class A macrophage scavenger receptors. Electron microscopic study of flexible, multidomain, fibrous proteins and determination of the disulfide bond pattern of the scavenger receptor cysteine-rich domain.
8394868 1993 Structures and high and low affinity ligand binding properties of murine type I and type II macrophage scavenger receptors.
8391600 1993 [Structural and function of the human macrophage scavenger receptor].
8093617 1993 Structure, organization, and chromosomal mapping of the human macrophage scavenger receptor gene.
2251254 1990 Human macrophage scavenger receptors: primary structure, expression, and localization in atherosclerotic lesions.
1519666 1992 Coexpression of type I and type II human macrophage scavenger receptors in macrophages of various organs and foam cells in atherosclerotic lesions.