Property Summary

NCBI Gene PubMed Count 9
PubMed Score 40.74
PubTator Score 8.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (4)

PMID Text
24144731 SC4MOL is situated within the psoriasis susceptibility locus PSORS9, and may be a genetic risk factor for common skin conditions. [review]
22791750 variants in/near SC4MOL, were associated with FI and IR in this cohort of African Amer
21285510 human SC4MOL encodes a methyl sterol oxidase that may have a role in psoriasiform dermatitis, microcephaly, and developmental delay
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFLFCLPGF      1 - 70
LFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWERMPRWYFLLA     71 - 140
RCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHV    141 - 210
ILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA    211 - 280
YNEKRKKFEKKTE                                                             281 - 293
//

Text Mined References (13)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144731 2014 The role of sterol-C4-methyl oxidase in epidermal biology.
22791750 2012 Genome-wide association study identifies novel loci association with fasting insulin and insulin resistance in African Americans.
21285510 2011 Mutations in the human SC4MOL gene encoding a methyl sterol oxidase cause psoriasiform dermatitis, microcephaly, and developmental delay.
21269460 2011 Initial characterization of the human central proteome.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8663358 1996 Characterization of yeast methyl sterol oxidase (ERG25) and identification of a human homologue.