Property Summary

NCBI Gene PubMed Count 3
PubMed Score 447.74
PubTator Score 21.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Arthropathy 43 3.944 2.0
Osteoarthritis 184 3.506 1.8
nail-patella syndrome 16 3.058 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 3.8e-02

Gene RIF (2)

AA Sequence

MAAAVTIPGPRIGALQSSGLTLLLSLAAHCSGPQAKVLSPGGLDASGANLWASANCSLLQGFWCQPASQL      1 - 70
PRDQLSALIQRLALLQVPLQAWQLSCLANLASRCGLQDDFTLHPPNLLLFYNLSQVREADCRAFIRRAAQ     71 - 140
GDVELLSHLPDQRVALWRAAVACLVGAGLRLSASDQQLLGALVCDMDASSIGAADPHMLENLRRCPRLTA    141 - 210
AQRIALNSLLAGGKTSLGPPGSWTLEGLQALGPLATYISPHLWAQVQEAVGLGFFRSVVASCQVGRLGQR    211 - 280
EARCFVTSFLESKTKPVSSRPRLSTGNITAATLRDDLFLVHYDCAELESCLDGCILRTNLDTLLQHLLPT    281 - 350
ECQHVVKAKLAQIYPQGLPEDQLRLITSLVYLYSRTEIGQWSITSQDTVMALLASDVALENQTEAVLQKF    351 - 420
LEHNGTVSGALLLAIGGTRLCWMSPHQIQTIHPQELRLAGALDLSSCPQSRKDVLYTKAHETFGSSGTLA    421 - 490
AYYRLMRPYLGGSPGGAQPPSPVPPGGAPVEELRHLAHANISMDIDTFTSLNPLELQSLDVGNVTALLGH    491 - 560
NVGDLQKARSHPTVRAWLRSLNSSTLGQLGLDASPTSPTGPAHGTRGPPSTTHQVLHLVHTSGLPTNDAQ    561 - 630
ASTSGSLWAPLGYLPLAMALPCSLLCLLHWGTCILVSVDSVASGWLGSQGSGAGKTEVLDSAGRPLGLTG    631 - 700
QL                                                                        701 - 702
//

Text Mined References (4)

PMID Year Title