Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.15
PubTator Score 6.12

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.189 6.4e-04
acute quadriplegic myopathy 1.329 7.1e-06
tuberculosis 1.100 1.2e-05
diabetes mellitus -1.200 1.4e-03
subependymal giant cell astrocytoma -1.362 5.2e-03
Pick disease -1.200 1.2e-03
ovarian cancer 1.900 3.0e-06

Gene RIF (4)

PMID Text
24913909 Studies identi fi ed a novel signal of nuclear localization (NLS) in all MSL1 protein isoforms and found that the combination of both NLS allows for its intra-nuclear focal accumulation and nuclear transport of TTC4 while all MSL1 isoforms affect H4K16Ac.
24205110 The MSL1 bound to Nupr1, with a moderate affinity (2.8 microM) in an entropically-driven process. MSL1 did not bind to non-damaged DNA, but it bound to chemically-damaged-DNA with a moderate affinity (1.2 microM) also in an entropically-driven process.
19650074 MSL1 plays an important role in mediating irradiation-induced DNA repair through formation of HAT complexes and interaction with 53BP1. P8 acts as a negative regulator of this process by interacting with MSL1 and preventing its role on HAT activity.
16227571 A multisubunit human histone acetylase complex that contains homologs of the Drosophila MSL proteins MOF, MSL1 (hampin A), MSL2, and MSL3 was described. This complex is responsible for histone H4 lysine-16 acetylation of all cellular chromosomes.

AA Sequence

MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDEPGAAEAHFLPRHRKLKEPGPPLASSQGGSPAPS      1 - 70
PAGCGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPAAAGAGCSPRPKYQAVLPIQTG     71 - 140
SLVAAAKEPTPWAGDKGGAASPAATASDPAGPPPLPLPGPPPLAPTATAGTLAASEGRWKSMRKSPLGGG    141 - 210
GGSGASSQAACLKQILLLQLDLIEQQQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERH    211 - 280
KLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHKRKSPFGSTERKTPVKKLAPE    281 - 350
FSKVKTKTPKHSPIKEEPCGSLSETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEI    351 - 420
EDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSWRDHSVEPLRDPN    421 - 490
PSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDD    491 - 560
VESLMITPFLPVVAFGRPLPKLTPQNFELPWLDERSRCRLEIQKKQTPHRTCRK                    561 - 614
//

Text Mined References (24)

PMID Year Title
24913909 2014 Two distinct nuclear localization signals in mammalian MSL1 regulate its function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205110 2013 Deciphering the binding between Nupr1 and MSL1 and their DNA-repairing activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084835 2012 Msl1-mediated dimerization of the dosage compensation complex is essential for male X-chromosome regulation in Drosophila.
22547026 2012 Structural insight into the regulation of MOF in the male-specific lethal complex and the non-specific lethal complex.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21217699 2011 Structural basis for MOF and MSL3 recruitment into the dosage compensation complex by MSL1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
19650074 2009 p8/nupr1 regulates DNA-repair activity after double-strand gamma irradiation-induced DNA damage.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16543150 2006 Nuclear pore components are involved in the transcriptional regulation of dosage compensation in Drosophila.
16227571 2005 A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12698291 2003 Evolution of chromatin-remodeling complexes: comparative genomics reveals the ancient origin of "novel" compensasome genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.