Property Summary

NCBI Gene PubMed Count 62
PubMed Score 99.67
PubTator Score 125.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma 2.300 6.0e-09
atypical teratoid / rhabdoid tumor 1.500 2.0e-04
medulloblastoma, large-cell 1.600 1.3e-04
primitive neuroectodermal tumor 1.200 8.9e-05
lung cancer 1.200 1.8e-03
psoriasis -1.100 5.9e-14

Gene RIF (52)

PMID Text
27281208 studies highlight Msi reporters as a unique tool to identify therapy resistance, and define Msi signalling as a central regulator of pancreatic cancer
26673327 Concomitant loss of function of both MSI1 is sufficient to abrogate the growth of human colorectal cancer cells, and Msi gene deletion inhibits tumorigenesis in several mouse models of intestinal cancer.
26294058 Msi1 overexpression is associated with Esophageal Squamous Cell Carcinoma.
26191146 Suggest high level of Musashi-1 protein expression is associated with poor survival in endometrioid adenocarcinoma patients.
26100017 The findings uncover a role for MSI1 as a central regulator of cell adhesion pathways that contribute to Glioblastoma by influencing cell adhesion, morphology, migration, and invasion.
25971681 Musashi-1 and ALDH1 expression are closely related to metastasis of ovarian adenocarcinoma.
25940441 Our results demonstrate that miR-137 acts as a tumor-suppressive miRNA in colorectal cancers and negatively regulates oncogenic Musashi-1
25888190 data suggest that in response to environmental cues that oppose cell cycle progression, regulation of Musashi function is required to promote target mRNA translation and cell fate transition
25851660 This review highlights both the essential contribution of RBPs to posttranscriptional regulation and the importance of the Musashi family as master regulators of male gamete development--{REVIEW}
25773390 we suggest that Musashi-1, Lgr5, and pEGFR are overexpressed in human SIAs and may play roles in human SIA carcinogenesis and progression.
25747387 Msi1 is a mediator of TRAIL resistance in HCC cells
25394506 Knockdown of endogenous Msi1 protein inhibited the growth and tumor formation by activating the cell cycle suppressor p21cip
25380226 Msi proteins contribute to an epithelial gene expression program in neural and mammary cell types.
25362645 High Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.
24787949 an association between a Musashi-1 genotype and lung cancer risk
24525742 NOTCH3 signaling regulates MUSASHI-1 expression in metastatic colorectal cancer cells.
24452324 The principal findings included significantly higher level of Msi-1 expression in younger gastric cancer patients compared to older ones, and probable association of tumor Msi-1 expression in young gastric cancer patients with more aggressive tumor type.
24444033 oncogenic role in hepatocellular carcinoma may be through modulation of cell growth and cell cycle by activating Wnt pathway via direct downregulation of APC and DKK1
24365097 Aberrant Musashi-1 expression in adenomyosis may be involved in the pathogenesis and pathophysiology of adenomyosis, but it does not correlate with changes in serum estradiol or progesterone levels.
24163304 Msi1 was significantely overexpressed in 41.5 % of tumor samples.
24151393 Msi-1-positive cells may play a key role in the early events of gastric carcinogenesis and may be involved in invasion and metastasis of gastric cancer cells.
24061461 our data demonstrated that Musashi 1 is highly and un-differentially expressed in both examined tumoral and apparently normal bladder tissues.
24057325 High levels of Musashi-1 were associated with gliomas.
24022895 Musashi-1 mediates the downregulation of the 26S proteasome by binding to the mRNA of NF-YA, the transcriptional factor regulating 26S proteasome subunit expression
23715514 Msi1 regulates the proliferation of stem-like spheroid lung tumor cells in associated with Notch and Wnt signaling.
23418578 study provides novel insights into Hedgehog/Msi1 signaling and its role in the regulation of the self-renewal capability of human umbilical cord blood (UCB)-derived mesenchymal stem cells
23164718 was a statistical difference between the MSI1 gene expression in intestinal versus diffuse type gastric cancer
23017339 Msi1 has different expression patterns in glioma from Grade I to Grade IV, and the different expression patterns play diverse roles in angiogenesis of glioma.
22985791 Msi1 functions as a regulator of multiple processes in medulloblastoma formation and could become an important therapeutic target.
22258704 Musashi1 is regulated by HuR via mRNA translation and stability in glioblastoma cells.
22113197 Overexpression of MSI1 was sufficient to increase Hes1, stimulate proliferation, inhibit apoptosis and reduce insulin expression, whereas Msi1 knockdown had the converse effects on proliferation and insulin expression.
22012766 Our study suggested that Msi-1 and/or ALDH1 expression might be closely related to the carcinogenesis, progression, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma.
21881409 study concludes that tumor suppressor miRNAs are direct and influential regulators of Msi1, affecting its expression pattern during tumorigenesis of malignant nervous system tumors
21829201 CD44 and Musashi-1 are frequently expressed in both premalignant gastric lesions and invasive gastric cancer, whereas CD133 expression is restricted mainly to neoplastic tissues.
21751144 Msi-1 positive cells have several characteristics of stem cells, such as high proliferative potentiality and multipotency
21442350 Overexpression of Msi-1 was associated with lymph node metastasis in colon cancer.
21199875 APC as a key factor in MSI1 regulation through Wnt signaling and identify APC mRNA as a novel target of translational inhibition by MSI1.
21165952 We conclude that Ishikawa cells contain a subpopulation of cells with stem cell-like properties. Musashi-1 modulates endometrial carcinoma cell cycle progression and apoptosis via the stemness-related factors Notch-1, Hes-1 and p21(WAF1/CIP1)
20727204 Msi1 is a negative prognostic indicator of breast cancer patient survival, and is indicative of tumor cells with stem cell-like characteristics.
19714342 Musashi-1 and beta1-integrin may be involved in human colorectal tumor carcinogenesis and progression.
19258308 Msi1 affects a network of genes and could function as a master regulator during development and tumor formation.
19214660 Msi-1 suppresses expression of Paneth cell-specific genes in IECs, presumably through a pathway independent from Notch or Wnt
18826648 Msi1 may promote cancer cell proliferation and survival as its loss seems to have a detrimental effect in the maintenance of medulloblastoma cancer cells.
18473332 study demonstrated endometrial expression of Musashi-1; Musashi-1 expressing stromal cell & cell group numbers were increased in endometriotic & endometrial carcinoma tissue compared to secretory endometrium
18471519 Msi-1 involved in cancer cell proliferation, inhibition of apoptosis, and mitotic catastrophe, suggesting an important potential mechanism for its role in tumorigenesis.
18419830 may be involved in carcinogenesis of the cervix and progression of cervical carcinoma
17549630 We conclude that Helicobacter pylori infection strongly induces Msi-1 in the gastric corpus. Given its expression in dividing cells, Msi-1 may modulate the state of gastric progenitor cells.
16777095 Results indicate that Musashi1 is a useful marker for immature cells in periventricular areas inhabited by stem cells, progenitor cells, and differentiating cells.
16214366 Msi-1's ability to regulate progenitor maintenance is through the translational inhibition of the cyclin-dependent kinase inhibitor p21WAF-1.
16106215 The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in Alzheimer disease and Pick disease suggests that it may play a role in the pathogenesis of these lesions.
12907678 analysis of RNA binding affinity of domains in mouse musashi1 protein
12054577 association between Musashi1 and the development of liver cancer

AA Sequence

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD      1 - 70
QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML     71 - 140
MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF    141 - 210
MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA    211 - 280
AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG    281 - 350
PLIATAFTNGYH                                                              351 - 362
//

Text Mined References (67)

PMID Year Title
27281208 2016 Image-based detection and targeting of therapy resistance in pancreatic adenocarcinoma.
26673327 2015 The Msi Family of RNA-Binding Proteins Function Redundantly as Intestinal Oncoproteins.
26294058 2015 Role of Msi1 and MAML1 in Regulation of Notch Signaling Pathway in Patients with Esophageal Squamous Cell Carcinoma.
26191146 2015 Prognostic value of Musashi-1 in endometrioid adenocarcinoma.
26100017 2015 RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.
25971681 2015 Musashi-1 Expression is a Prognostic Factor in Ovarian Adenocarcinoma and Correlates with ALDH-1 Expression.
25940441 2015 Tumor suppressive microRNA-137 negatively regulates Musashi-1 and colorectal cancer progression.
25888190 2015 Neural stem and progenitor cell fate transition requires regulation of Musashi1 function.
25851660 RNA binding proteins in spermatogenesis: an in depth focus on the Musashi family.
25773390 2015 Correlation of Musashi-1, Lgr5, and pEGFR expressions in human small intestinal adenocarcinomas.
25747387 2015 Msi1 confers resistance to TRAIL by activating ERK in liver cancer cells.
25394506 2015 Downregulation of Msi1 suppresses the growth of human colon cancer by targeting p21cip1.
25380226 2014 Musashi proteins are post-transcriptional regulators of the epithelial-luminal cell state.
25362645 2014 Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.
24787949 2014 Cancer stem cell marker Musashi-1 rs2522137 genotype is associated with an increased risk of lung cancer.
24525742 2014 NOTCH3 signaling regulates MUSASHI-1 expression in metastatic colorectal cancer cells.
24452324 2014 Musashi-1 expression and clinicopathological significance in young gastric cancer patients: a matched case-control study.
24444033 2015 Musashi1 regulates survival of hepatoma cell lines by activation of Wnt signalling pathway.
24365097 2014 Increased expression of the adult stem cell marker Musashi-1 in the ectopic endometrium of adenomyosis does not correlate with serum estradiol and progesterone levels.
24163304 2014 Clinicopathological sex- related relevance of musashi1 mRNA expression in esophageal squamous cell carcinoma patients.
24151393 2013 Expression and significance of Musashi-1 in gastric cancer and precancerous lesions.
24061461 The stem cell self-renewal gene, Musashi 1, is highly expressed in tumor and non-tumor samples of human bladder.
24057325 2013 Prognostic value of Musashi-1 in gliomas.
24022895 2014 The RNA-binding protein Musashi-1 regulates proteasome subunit expression in breast cancer- and glioma-initiating cells.
23715514 2013 Musashi1 as a potential therapeutic target and diagnostic marker for lung cancer.
23418578 2013 The effects of Hedgehog on the RNA-binding protein Msi1 in the proliferation and apoptosis of mesenchymal stem cells.
23164718 2013 MSI1 overexpression in diffuse type of gastric cancer.
23017339 2013 The expression patterns of Msi1 related with the glioma grade and the cytoplasmic Msi1 promotes angiogenesis.
22985791 2012 The RNA-binding protein Musashi1 affects medulloblastoma growth via a network of cancer-related genes and is an indicator of poor prognosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22258704 2012 The oncogenic RNA-binding protein Musashi1 is regulated by HuR via mRNA translation and stability in glioblastoma cells.
22113197 2011 Musashi expression in ?-cells coordinates insulin expression, apoptosis and proliferation in response to endoplasmic reticulum stress in diabetes.
22012766 Identification of musashi-1 and ALDH1 as carcinogenesis, progression, and poor-prognosis related biomarkers for gallbladder adenocarcinoma.
21881409 The oncogenic RNA-binding protein Musashi1 is regulated by tumor suppressor miRNAs.
21829201 2011 Sequential expression of putative stem cell markers in gastric carcinogenesis.
21751144 2011 Expression of a putative stem cell marker Musashi-1 in endometrium.
21442350 2011 Msi-1 is a predictor of survival and a novel therapeutic target in colon cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21199875 2011 Novel double-negative feedback loop between adenomatous polyposis coli and Musashi1 in colon epithelia.
21165952 2011 The adult stem cell marker Musashi-1 modulates endometrial carcinoma cell cycle progression and apoptosis via Notch-1 and p21WAF1/CIP1.
20727204 2010 Musashi1 regulates breast tumor cell proliferation and is a prognostic indicator of poor survival.
19714342 2010 Expression of putative stem cell genes Musashi-1 and beta1-integrin in human colorectal adenomas and adenocarcinomas.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19258308 2009 Genomic analyses of musashi1 downstream targets show a strong association with cancer-related processes.
19214660 2009 Musashi-1 suppresses expression of Paneth cell-specific genes in human intestinal epithelial cells.
18826648 2008 Musashi1 modulates cell proliferation genes in the medulloblastoma cell line Daoy.
18473332 2008 Increased expression of the adult stem cell marker Musashi-1 in endometriosis and endometrial carcinoma.
18471519 2008 Knockdown of RNA binding protein musashi-1 leads to tumor regression in vivo.
18419830 2008 Stem-cell-abundant proteins Nanog, Nucleostemin and Musashi1 are highly expressed in malignant cervical epithelial cells.
17549630 2008 Helicobacter pylori infection induces candidate stem cell marker Musashi-1 in the human gastric epithelium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16777095 2006 Musashi1 antigen expression in human fetal germinal matrix development.
16541075 2006 The finished DNA sequence of human chromosome 12.
16214366 2006 The RNA-binding protein Musashi-1 regulates neural development through the translational repression of p21WAF-1.
16106215 2005 Ectopic expression of Musashi-1 in Alzheimer disease and Pick disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12924647 2003 Expression of Musashi-1 in human normal colon crypt cells: a possible stem cell marker of human colon epithelium.
12907678 2003 Origin of higher affinity to RNA of the N-terminal RNA-binding domain than that of the C-terminal one of a mouse neural protein, musashi1, as revealed by comparison of their structures, modes of interaction, surface electrostatic potentials, and backbone dynamics.
12054577 2002 Expression of the Musashi1 gene encoding the RNA-binding protein in human hepatoma cell lines.
11951628 2002 Identification of Musashi1-positive cells in human normal and neoplastic neuroepithelial tissues by immunohistochemical methods.
11896183 2002 Musashi: a translational regulator of cell fate.
11686236 2001 Musashi1, an evolutionarily conserved neural RNA-binding protein, is a versatile marker of human glioma cells in determining their cellular origin, malignancy, and proliferative activity.
11588182 2001 Rna-binding protein Musashi2: developmentally regulated expression in neural precursor cells and subpopulations of neurons in mammalian CNS.
11359897 2001 The neural RNA-binding protein Musashi1 translationally regulates mammalian numb gene expression by interacting with its mRNA.
11284014 2001 Expression of the neural RNA-binding protein Musashi1 in human gliomas.
9790759 1998 The human Musashi homolog 1 (MSI1) gene encoding the homologue of Musashi/Nrp-1, a neural RNA-binding protein putatively expressed in CNS stem cells and neural progenitor cells.