Property Summary

NCBI Gene PubMed Count 634
PubMed Score 1414.97
PubTator Score 1540.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.400 1.4e-06
group 3 medulloblastoma 1.800 4.1e-05
atypical teratoid/rhabdoid tumor 1.300 1.2e-05
medulloblastoma, large-cell 1.300 1.1e-05
non-small cell lung cancer 1.686 2.0e-20
lung cancer 2.500 7.1e-05
diabetes mellitus -1.100 1.1e-03
Breast cancer 1.900 4.8e-02
nasopharyngeal carcinoma 1.200 1.7e-03
lung adenocarcinoma 1.212 1.1e-04
acute myeloid leukemia -1.400 2.8e-02
ovarian cancer 1.500 2.5e-04
pituitary cancer 1.100 7.6e-05

Protein-protein Interaction (5)

Gene RIF (567)

PMID Text
27069191 The proportion of deaths from extra-colonic cancer was significantly higher in Japanese families with Lynch syndrome with MSH2 mutation
27013479 In Lynch syndrome families, prostate cancer was associated with mutations in MSH2 with loss of the mismatch repair protein.
26728996 data supported an interdependence of mismatch repair proteins, particularly MLH1 and MSH2, in the mediation of apoptosis in human colorectal carcinoma cell lines
26544533 Heterozygous germline mutations in any of the mismatch repair (MMR) genes, MLH1, MSH2, MSH6, and PMS2, cause Lynch syndrome (LS), an autosomal dominant cancer predisposition syndrome.
26498247 Authors propose an Alu-mediated recombination model to explain the origin of the cryptic paracentric inversion of MSH2 exons 2-6 causes Lynch syndrome.
26477961 Pathogenic mutations were only confined to MSH2 and identified in 28.8% of Singapore families with Hereditary Colorectal Cancer.
26381082 foot-drop is frequently associated with NEB gene mutations . This result supports the indication deriving from the yeast model that BRCA1 driven tumorigenesis may be modulated by MSH2.
26224637 MutSalpha, proliferating cell nuclear antigen, and replication factor C activate MutLalpha endonuclease to remove the 1-nucleotide Okazaki fragment flaps
26221039 study identifies an HDAC10-mediated regulatory mechanism controlling the DNA mismatch repair function of MSH2.
26215063 MSH2, MSH6, and EXO1 genes were overexpressed in gastroesophageal cancers.
26212458 The mismatch-binding protein MutS beta, a heterodimer of MSH2 and MSH3, activates ATR in response to DNA double-strand breaks.
26097592 Loss of MSH-2/MSH-6 expression was correlated with the right-colon location, poor and mucinous differentiation in colorectal adenocarcinoma.
26088318 Expression levels of DNA repair genes, such as MSH2, may serve as informative biomarkers for identifying patients with T2 Diabetes and coronary artery disease.
26053027 This retrospective cohort study investigated the risk factors associated with the development of colorectal cancer in patients with MLH1 and MSH2 germline mutations.
26025730 A role of MSH2 protein in glioblastoma resistance to temozolomide
25829401 We identified several genes (FasL, MSH2, ABCC5, CASP3, and CYP3A4)that showed association with PFS in patients with osteosarcoma. These pharmacogenetic risk factors might be useful to predict treatment outcome
25804231 These results suggest that the -93G>A polymorphism of the MLH1 gene singly and in combination with the Gly322Asp polymorphism of the MSH2 gene may increase the risk of endometrial cancer.
25664706 When controlling for surgical and pathologic factors, mismatch repair protein expression did not predict lymph node yield after colectomy for Colon cancer .
25640028 Prostate cancer occurs at a younger age mainly for mutations in MSH2 gene.
25639900 Studies indicate that each of the three neoplasm protein variants in BRCA1, BRCA2 and MSH2 would normally be reported as pathogenic based on widely accepted guidelines.
25598504 Our data present, for the first time, evidence that inherited MLH1 c.-93G>A, MSH2 c.211 + 9C>G, MSH3 c.3133G>A, and EXO1 c.1765G>A abnormalities of DNA MMR pathway are important determinants of head and neck squamous cell carcinoma
25561800 Report mutations in SNP loci of MSH2 in neoplastic intestinal polyps and colorectal cancer.
25560462 Intronic SNPs, gene-gene and gene-environment interactions in hMSH2 might be associated with susceptibility to colorectal cancer.
25503122 The survival time of patients with osteosarcoma may be predicted by local expression of MSH6 and MSH2/6 in surgical primary tumor resections.
25490383 MSH2 expression downregulation by Hsp90 inhibition enhances cytotoxicity affected by tamoxifen in human lung cancer cells
25410477 Data indicate that MutS homologue 2 (hMSH2) proteins stimulate the proliferation of gammadeltaT cells in mononuclear leukocytes.
25255306 Somatic rearrangements in MSH2 and MSH6 are an important mechanism leading to hypermutation and microsatellite instability in advanced prostate cancer.
25216868 Among all the 32 families with mutations, families with hMSH2 mutation had a higher ratio of synchronous and metachronous colon cancers than families with hMLH1 mutation (33 vs. 6%, P=0.04).
25200962 A novel mutation consisting in a G deletion at 914 codon of the exon 16 in the MSH2 gene that is associated with HNPCC is described.
25175513 Results indicate that the expression of hMSH2 is upregulated in ovarian carcinoma cell lines and tissues after paclitaxel treatment, and hMSH2 overexpression is related to paclitaxel resistance and poor prognosis.
25134804 Gly322Asp polymorphism of the hMSH2 gene may be linked with Triple-negative breast cancer occurrence in Polish women
25133505 The study evaluates the frequency and distribution of mutations in the MLH1, MSH2 and MSH6 genes within a cohort of families with Lynch syndrome in Cyprus.
25107687 A new mutation in MSH2 (c.969_970delTC) was identified in Hungarian hereditary non-polyposis colorectal cancer patients.
25106712 We here demonstrate the causative role of the first germline mutation of MSH2, c.1249-1251 dupGTT (p.417V-418I dupV), associated with normal hMSH2 expression and lack of hMSH6 protein despite a normal MSH6 gene sequence
25083964 Some uterine carcinosarcomas show loss of MSH2.
24995467 immunohistochemical expression of MLH1, MSH2, and MSH6 in initial glioblastoma is not associated with patient survival
24989436 Our database and literature searches retrieved 30 MLH1, 22 MSH2, 4 MSH6 and 9 PMS2 alternative transcripts, many predicted to introduce premature termination codons
24966277 MSH2 role in aberrant DNA damage responses
24933000 Challenges in assessing pathogenicity based on frequency of variants in mismatch repair genes: an extreme case of a MSH2 variant and a meta-analysis.
24874052 Data indicate that eight of 44 (18 %) patients had negative MLH1 protein expression and 25/44 (57 %) patients had negative MSH2 pprotein expression.
24793746 None of single-nucleotide polymorphisms located at MSH2 were significantly associated with prognosis of colorectal cancer in China.
24643686 Immunohistochemistry revealed loss of expression for MLH1, MSH2, MSH6, and PMS2 in 15, 21, 13, and 15 % of cases, respectively...we found a perfect association between MMR immunohistochemical analyses and MSI molecular investigation
24612059 Serrated colorectal carcinoma as proposed to arise from serrated adenoma is characterized by loss of Dna repair protein, hMSH2.
24530475 Down-regulation of MSH2 expression by an Hsp90 inhibitor enhances pemetrexed-induced cytotoxicity in non-small-cell lung cancer.
24501230 The MSH2-M813V variant is not disease causing.
24444820 MSH2 expression in endometrial carcionma was associated with BMI, however a link between BMI and maintenance of the DNA mismatch repair system is not supported.
24400091 Promoter methylation of MLH1, PMS2, MSH2 and p16 is a phenomenon of advanced-stage HCCs.
24395779 analysis of similarities and differences in hMSH2-hMSH6 mismatch recognition and sliding-clamp formation between a D-loop recombination intermediate and linear duplex DNA
24366688 High Promoter methylation of MSH2 is associated with esophageal squamous cell carcinoma.
24360395 The frequency of promoter hypermethylation found on this DNA repair gene was elevated
24333619 Somatic mutations in MLH1 and MSH2 are a frequent cause of mismatch-repair deficiency in Lynch syndrome-like tumors.
24323032 Data show that endometrial cancer screened by testing for tumor MLH1 methylation in individuals with MLH1 immunohistochemistry loss, and germline mutations exhibiting loss of MSH6, MSH2, or PMS2 or loss of MLH1/PMS2 with absence of MLH1 methylation.
24317816 promoter hypermethylation of hMLH1 and hMSH2 genes may be one of the causes of inactivation of these genes in sporadic colorectal cancer.
24212987 lower MSH2 expression might contribute to a higher clinic aggressiveness of head and neck squamous cell carcinoma by promoting an unfavorable outcome.
24185125 MSH2 was reduced in 23.4% of non-small-cell lung carcinoma patients and was significantly associated with adenocarcinoma.
24141788 Results show that MSH6 and MSH2 expressions are downregulated by YB-1.
24122742 MSH2 patients present less frequently with only CRC, manifest more multiple primary cancers, develop more extracolonic cancers, non-EC only cancers and carry a greater risk for urinary tract cancer (UTC).
24090359 The in silico analysis predicted altered splicing for MSH2 c.1276 + 1G > T, MSH2 c.1662-2A > C, and MSH2 c.2459-18delT.
24078570 MSH2 interacts with MSH6 protein in yeast two-hybrid system.
24073290 Loss of MSH2 expression associated with low-grade astrocytomas
24039744 Molecular characterization of MSH2 large genomic rearrangements, which may have important implications in Lynch syndrome diagnosis
23990280 MSH2 founder mutations in Ashkenazi Jews with Lynch syndrome
23904372 The expression of hMSH2 and PDCD4 in miR-21-inhibiting T98G cells.
23865379 changes in the immunoexpression of mismatch proteins MLH1 and MSH2 are related to the process of squamous cell carcinogenesis of the lower lip
23817394 The aim of the study was to determine the local incidence and pattern of immunohistochemical expression of hMLH1, hMSH2 and hMSH6 in a series of colorectal carcinomas
23794306 Our study aimed to assess the frequency and molecular characteristics of the Lynch syndrome in Moroccan early-onset colorectal cancers patients.
23787767 Reduced expression of MSH2 is associated with laryngeal squamous cell carcinoma.
23573243 Mutation spectrum and frequency of hMLH1 and hMSH2 genes in sporadic Lynch syndrome and colorectal cancer.
23526924 The prevalence of mutations of MLH1 and MSH2 in Amsterdam-criteria positive, Amsterdam-criteria negative and sporadic colorectal cancers was around 45%, 25% and 15%, respectively. (review)
23485110 MiR-21 could obviously downregulate the expression of MSH2.
23434150 Data indicate no evidence that the SNPs associated with colorectal cancer (CRC) in the general population are modifiers of the risk for MLH1, MSH2, MSH6 and PMS2 MMR gene mutation carriers overall.
23401454 Studies identified 21 deleterious mutations MLH1, MSH2, MSH6 and BRAF.
23391514 MSH6 is unstable in the absence of MSH2.
23376256 MSH2 expression significantly enhances cell radiosensitivity to low dose ionizing radiation.
23329266 MSH2 splice site mutations are associated with increased risk of hereditary non-polyposis colorectal cancer.
23301373 Inactivation of mismatch repair gene, hMSH6, is responsible for microsatellite instability or replication error and is seen in colorectal cancer
23255516 study obtained unbiased estimates of colorectal cancer and endometrial cancer penetrance for MLH1 and MSH2 mutation carriers
23231927 In VIPoma, defects in the mismatch repair system especially in MSH2 may contribute to carcinogenesis, and increased CXCR4 may be associated with liver metastasis.
23170986 the high proportion of families with the MSH2 c.388_389del mutation indicates that screening for this alteration as a first step may be cost-effective in the genetic testing of Lynch syndrome suspects of Portuguese ancestry.
23149851 Defective hMSH2 expression is associated with early gastric carcinoma.
23143558 Expression of MSH2 mRNA correlates with serum estradiol level in colon cancer tissue.
23045530 Engineered disulfide-forming amino acid substitutions interfere with a conformational change in the mismatch recognition complex Msh2-Msh6 required for mismatch repair
22941650 siRNA knockdown of the MutSbeta subunits MSH2 or MSH3 impeded expansion of threshold-length CTG*CAG repeats.
22883484 Lynch Syndrome patients with MSH2 mutations are at an increased risk for not only upper tract urothelial cancer, but also bladder cancer. Mutations in the intron 5 splice site and exon 7 of the MSH2 gene increased the risk of urothelial cancer.
22865300 Findings show that MMR mRNA phenotypes may be added to the known biological differences between SQC and ADC. hMLH1 and hMSH2 phenotypes distributed differently according to the NSCLC stage.
22806311 MiR-21 expression was inversely correlated with hMSH2 expression in human lung cancer cell lines.
22781090 this can be particularly useful in families of Sardinian origin, in which MSH2 exon 8 deletions may represent 50% of the overall mutational spectrum of the four MMR genes causing Lynch syndrome.
22776989 MSH2 mutation with microsatellite instability is associated with new cases of Lynch syndrome.
22775459 Prophylactic hysterectomy with bilateral salpingo-oophorectomy be considered in female MSH2 mutation carriers who have completed childbearing.
22739024 The hMSH2(M688R) Lynch syndrome mutation may function as a dominant negative.
22669205 In 76 patients with colorectal neoplasms, 2 missense mutations were identified in MSH2. 7 patients had multiple mutations, MSH2 and KRAS.
22635031 Loss of hMSH2 is associated with endometrial cancer.
22614019 an enhanced downregulation of the miR-21 tumor-related targets, including MSH2, was observed in Ras-transformed keratinocytes.
22581703 The MSH2 VUS pair c.380A>G/c.982G>C (p.Asn127Ser/p.Ala328Pro), which nearly halves the repair capability of the wild-type MSH2 protein, is presumed to increase the cancer risk considerably.
22493490 Ectopic expression of human MutS homologue 2 on renal carcinoma cells is induced by oxidative stress with interleukin-18 promotion via p38 mitogen-activated protein kinase (MAPK) and c-Jun N-terminal kinase (JNK) signaling pathways.
22456432 Report loss of expression of hMLH1, hMSH2 and hMSH6 in small intestinal carcinomas.
22453149 The mutations in the MLH1 and MSH2 genes in Latvian Lynch syndrome high-risk families are highly heterogeneous.
22433851 Ectopically expressed human tumor biomarker MutS homologue 2 is a novel endogenous ligand that is recognized by human gammadelta T cells to induce innate anti-tumor/virus immunity.
22386861 The IVS10+12G>A and IVS126T>C polymorphisms in MSH2 gene appear to be associated with risk of gastric cancer in this Chinese population.
22378480 hMSH2 is differently expressed in the three main subtypes of sporadic renal cell carcinoma.
22371642 Germline mutations of MLH1 and MSH2 were identified in four Malaysian Lynch syndrome patients.
22331944 Mutations in MSH2 is associated with neoplasms.
22287095 Loss of MSH2 expression is associated with downregulation of HLA class I which contributes to immune escape resulting in endometrial carcinomas.
22277660 MSH2(wt)-MSH6(T1219D) fails to couple nucleotide binding and mismatch recognition, whereas MSH2(G674A)-MSH6(wt) has a partial defect in nucleotide binding.
22265839 study focuses on evaluating incidence of epigenetic aberrations in MSH2 genes and its clinical impact on the development of esophageal squamous cell carcinoma in a middle incidence area of China; suggested that MSH2 methylation in plasma would be a good predictor of disease-free survival for these patients before esophagectomy
22234160 The hMSH2 promoter sequence was unmethylated, in neural tube defects
22219001 the recurring Ashkenazi MSH2 mutations contribute little if any to sporadic and familial gastric and pancreatic cases in Israeli patients
22190034 HIV-1 PR is identified to have a physical interaction with mutS homolog 2, colon cancer, nonpolyposis type 1 (MSH2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22188959 The prevalence of the MSH2 mutated genes was similar between hyperplastic polyps and serrated adenomas
22188021 Approximately 50-80% of individuals who carry an MSH2 gene mutation are likely to develop a colon cancer by the age of 70 years
22179786 Studies indicate thar eukaryotes MutSbeta, a heterodimer of Msh2 and Msh3, recognizes insertion-deletion loops (IDLs) of 1-15 nucleotides, as well as DNA with a 3' single-stranded overhang.
22173703 Single nucleotide polymorphisms in MSH2 is associated with esophageal cancer.
22164234 Cytotoxicity induced by 5-FU is dependent on intact DNA MMR, with relative cell death correlating directly with hMutSalpha and/or hMutSss 5-FU binding ability (hMutSalpha>hMutSss)
22086974 missense mutation in exon 12 at codon 600 of the MSH2 gene in Lynch syndrome
22083523 Decrease in expression during neoadjuvant chemotherapy were more frequently observed for MGMT as compared to MLH1, MSH2 or BRCA1.
22067334 The lack of immunostaining for any of the 4 DNA mismatch repair proteins in this extremely unusual case was, therefore, related to a germline MSH2 mutation and somatic MLH1 promoter hypermethylation
22017238 Single Nucleotide Polymorphisms in MSH2 gene is associated with glioblastoma.
21988782 Somatic mutations in the hMLH1 and hMSH2 genes play a vital role in colorectal cancer and a high prevalence was found in this meta-analysis.
21960445 Complex MSH2/MSH3 discriminates between a repair-competent and a repair-resistant loop by sensing the conformational dynamics of the junctions. MSH2/MSH3 binds, bends and dissociates from repair-competent loops to signal downstream repair.
21946537 Somatic deletions of genes regulating MSH2 protein stability cause DNA mismatch repair deficiency and drug resistance in human leukemia cells.
21937421 precise stepwise kinetic mechanism for hMSH2-hMSH6 functions that appears to mimic G protein switches
21937259 This study suggested that hMSH2 may be altered in the late stages of oral carcinogenesis, with that role being interrelated in the pathogenetic pathway of oral squamous cell carcinoma .
21926548 Case Report: MSH2 P349L may increase the risk for pancreatic cancer beyond the usual mutations in DNA mismatch repair genes.
21911971 About 15 per cent colorectal tumors demonstrated absent MSH2, MSH6 and PMS2 protein expression in isolation or in combination with other MMR genes, which often predicts a germline mutation.
21855803 The presence of hMsh2-hMsh6 is indispensable for PCNA or Poleta recruitment to chromatin.
21821902 baculovirus overexpression and purification of recombinant human MutSbeta and three truncation mutants are presented here. Binding assays with heteroduplex DNA
21778331 Alu-mediated rearrangements in MSH2 gene is associated with a Lynch syndrome phenotype.
21766496 Promoter hypermethylation of MSH2 is associated with sporadic colorectal cancer.
21744313 Expression of the MLH-1 and MSH-2 antibodies was observed in all control slides
21732224 MSH2 gene expression was not a prognostic factor for overall survival in orectal cancer
21725088 N-methyl-N'-nitro-N-nitrosoguanidine (MNNG) triggers MSH2 and Cdt2 protein-dependent degradation of the cell cycle and mismatch repair (MMR) inhibitor protein p21Waf1/Cip1.
21706233 that CpG island methylation in hMSH2 and MGMT, but not hMLH1, is closely related to carcinogenesis in colorectal carcinomas presenting with a conventional adenoma-carcinoma sequence
21681552 Study adds new information about MSH2 gene mutations and contribute to better characterize Lynch Syndrome. High rate of novel mutations demonstrates the importance of defining MSH2 mutations in distinct Lynch Syndrome populations.
21674174 Detection of the methylated sequences of hMLH1, hMSH2, and MGMT appears to be promising as a predictive factor in primary esophageal squamous cell carcinoma.
21660619 MSH2 gene promoter methylation is associated with pancreatic cancer.
21642682 In Lynch syndrome, MSH6 mutations are associated with lower cancer risks than MLH1 or MSH2 mutations. Lifetime ovarian and endometrial cancer risks associated with MLH1 or MSH2 mutations were high but do not increase appreciably until after age 40
21615986 MSH2 and MLH1 mutations in Chinese hereditary non-polyposis colorectal cancer patients; 11 mutations found - 6 in MLH1, 5 in MSH2; 3 novel mutations in MLH1 (c.157_160delGAGG, c.2157dupT, c.-64G>T) found; 1 suspected hotspot MSH2(c.1168C>T) found
21559014 Germline mutations in MSH2 gene is associated with colorectal cancer.
21538690 MSH2 deficiency alone can lead to accelerated telomere shortening in normal human cells.
21528083 Data suggest that SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are potential prognostic markers in colorectal cancer.
21513149 association of mismatch repair gene single nucleotide polymorphisms (SNPs) with susceptibility to sporadic colorectal cancer (SCRC)
21431882 MSH2 mutation is associated with Lynch syndrome.
21425258 reduced expression of MMR proteins, but not changes in MGMT promoter methylation, is characteristic of glioblastomas recurring after the current standards of care.
21419771 Lifetime risks of colorectal/endometrial cancer in Ashkenazi MSH2 A636P carriers are high even after adjusting for ascertainment.
21419447 Of the patients with Lynch syndrome 91% had mutations in MSH2 rather than in MSH1 and 79% showed upper tract urothelial carcinoma a mean of 15.85 years after prior Lynch syndrome-type cancer.
21360204 show that an intronic mutation 478 bp upstream of exon 2 in the MSH2 gene causes Lynch syndrome through creation of a novel splice donor site with subsequent pseudoexon activation
21358597 Alterations in the mismatch repair proteins MSH2 and MLH1 and the direct repair protein MGMT may result from tumor development and/or progression.
21354521 Study reports a Taiwanese family with HNPCC and mutation analysis revealed a novel nonsense mutation (S611X) in MSH2 gene.
21348638 A significant downregulation of hMLH1, hMSH2, and hPMS2 expression was observed in Pca compared to benign prostatic hyperplasia (BPH).
21323960 epithelial cells from premalignant to malignant lip disease exhibited changes in the expression of hMSH2 proteins; these molecular change might contribute to lip carcinogenesis.
21309037 a novel approach to functionally characterize MSH2 missense mutations
21286667 MSH2 germline mutations are associated with colorectal carcinoma.
21285353 hMSH2 recruits ATR to DNA damage sites for activation during DNA damage-induced apoptosis.
21156417 alterations in this codon of the MSH2 gene might confer an increased susceptibility to breast cancer in Lynch families.
21155023 distribution of mutations in exon 1, 17 and 19 of MLH1 gene and in exon 2 of MSH2 gene showed significant differences between two racial groups
21128252 In one Lynch family, the index case with early-onset colon cancer was a carrier of a polymorphism in the MSH2 gene and two variants in the MSH3 gene. These variants were associated with the disease in the family.
21122410 There is a certain loss of expression of hMLH1 and hMSH2 proteins in sporadic colorectal carcinoma, and is correlated with the age of patients, lymphatic metastasis and different depth of cancer invasion.
21093954 no association between genetic polymorphism and the lung cancer risk
21093899 Common genetic variation in PTEN, PIK3CA, AKT1, MLH1, or MSH2 was not statistically significantly associated with endometrial cancer.
21091774 The significant association between reduced expression of both hMSH2 and hMLH1 and poor histologic grades of the tumor claims that these proteins are involved in the process of cancer progression.
21078976 miR-21 targets and down-regulates the core mismatch repair (MMR) recognition protein complex, human mutS homolog 2
21070872 Observational study of gene-disease association. (HuGE Navigator)
21056691 Observational study of gene-disease association. (HuGE Navigator)
21047769 by downregulating MSH2, TGF-beta contributed to resistance to DNA-damaging chemotherapy agents in cancer cells
21034533 Novel germline mutations in MLH1 and MSH2 in families with Lynch syndrome.
21029181 MSH2 expression was significantly associated with depth of invasion, tumor shape and muscular invasion. significantly associated with disease-free survival; also identified as an independent prognostic factor.
20937110 analysis of MLH1, MSH2 and MSH6 in Greek families with Lynch syndrome does not show a founder effect
20931542 IVS10+12G>A polymorphism in MSH2 is associated with colorectal cancer in Chinese.
20931542 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20872076 Mutation in MSH2 is associated with hereditary prostate cancer.
20850175 Observational study of gene-disease association. (HuGE Navigator)
20846263 MSH2 is hypermethylated in clear cell renal cell carcinoma.
20731661 Findings suggest that PARP1, XRCC1, MGMT, XPC, XPD and MSH2 SNP can be used as prognostic markers for patients with surgically resected early stage NSCLC.
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20708344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20672385 Lynch syndrome MSH2 missense mutants alter DNA repair and checkpoint response functions in vivo.
20591884 Aim of the present study was to establish whether carriers of mutations in mismatch repair genes MLH1,MSH2 or MSH6 are at increased risk of urinary bladder cancer. Found men carrying an MSH2 mutation and their first degree relatives were at highest risks.
20591884 Observational study of gene-disease association. (HuGE Navigator)
20564624 These results suggest that genetic variants in the DNA repair pathways may be involved in GB carcinogenesis etiology.
20564624 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20505253 The aim of this study was to analyse the hMSH2 gene expression in sporadic colorectal cancer cells of Caucasian patients.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20495877 Mutations in MSH2 is associated with colorectal cancer.
20458443 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20438357 significant association between the CC genotype of MSH2 and reduced risk of disease suggests that the gIVS12-6T --> C substitution at the splice-acceptor site may affect the risk of head and neck cancer
20438357 Observational study of gene-disease association. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20388775 Somatic hypermethylation of MSH2 is a frequent event in Lynch Syndrome colorectal cancers
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373145 the MSH2 c.2210G>A alteration could be considered as a founder mutation for the Turkish population due to its identification in five different Lynch syndrome families and absence in control group
20368715 Observational study of gene-disease association. (HuGE Navigator)
20332274 These findings suggest that higher calcium and vitamin D intakes may result in increased MSH2 and MLH1 activity in the normal colorectal mucosa of sporadic adenoma patients
20305446 21 Chilean families with Lynch syndrome showed 3 mutations in MSH2.
20223108 MLH1, MSH2 and MSH6 expression in initial glioblastoma lesions is significantly associated with the Ki67 antigen proliferation index.
20210238 Observational study of gene-disease association. (HuGE Navigator)
20206180 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20181625 There is no statistically significant association between the expression of MSH2 and overall survival or relapse of patients with laryngeal cancer. Nuclear MSH2 staining was statistically significantly correlated to Ki-67 expression.
20160730 Strong role of MutSbeta in insertion-deletions repair indicates MSH3 deficiency in tumours with low dinucleotide and no mononucleotide repeat instability.
20154325 the MutSbeta-MutLalpha interaction is mediated in part by residues ((L/I)SRFF) embedded within the MSH3 PCNA-binding motif
20150366 Observational study of gene-disease association. (HuGE Navigator)
20095990 Haplotype analyses suggest a founder effect of the c.[2635-3T>C; 2635-5C>T] MSH2 mutation and expression studies support a pathogenic role of this mutation.
20095990 Observational study of gene-disease association. (HuGE Navigator)
20090515 unbalanced intracellular distribution between nucleus and cytoplasm in gastric adenocarcinomas; lack of expression in gastrointestinal stromal tumors
20072951 hMLH1 and hMSH2 proteins may be involved in ovarian carcinogenesis.
20064472 Results support a passive mechanism for chromatin remodeling whereby hMSH2-hMSH6 sliding clamps trap localized fluctuations in nucleosome positioning and/or wrapping that ultimately leads to disassembly.
20056646 Observational study of gene-disease association. (HuGE Navigator)
20028567 Observational study of gene-disease association. (HuGE Navigator)
20004149 hMSH2, hMLH1 and PCNA localize to the chromatin during S-phase, and accumulate to a greater extent in cells treated with a DNA alkylating agent.
19950599 The expression of CDC6 was positively correlated with hMSH2 in cervical cancer.
19930554 loss of heterozygosity at part of the informative loci confined to the MLH1 or MSH2 gene (heterozygous LGR region, SNP, or microsatellite) is a novel finding
19911012 Germline mutation in MSH2 contributes to both Muir-Torre and Lynch Syndrome.
19900449 Observational study of gene-disease association. (HuGE Navigator)
19898223 Young women with endometrioid carcinomas who show loss of mismatch proteins are at risk for high-grade tumors with worse clinical outcomes.
19893772 Lynch syndrome was confirmed or highly suspected in patients (eight of 56) by the identification of a deleterious mutation or variant likely to be deleterious in hMSH2 mismatch repair gene.
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19876921 Observational study of gene-disease association. (HuGE Navigator)
19861671 MLH1 and MSH2 mutation carriers had a similar increase in risk of developing pancreatic cancer compared with the general population.
19861671 Observational study of gene-disease association. (HuGE Navigator)
19818066 MSH2 and MLH1 protein expression was not altered in squamous cell carcinoma from organ transplant recipients on azathioprine and there was no difference in expression between SCCs from OTRs and immunocompetent patients.
19818066 Observational study of gene-disease association. (HuGE Navigator)
19760518 Ten different pathological mutations were found in 54 non-related cases of Lynch syndrome, two of which had not previously been reported--one in MLH1 and the other in MSH2
19759184 IVS10+12A>G polymorphism in hMSH2 gene associated with colorectal cancer.
19759184 Observational study of gene-disease association. (HuGE Navigator)
19741564 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19734583 The expression loss rate of MLH1 and MSH2 in the hereditary nonpolyposis colorectal cancer group was higher than that in the control group.
19728162 Four Lynch syndrome patients were found to carry a total of five MLH1 or MSH2 variants.
19723918 Observational study of gene-disease association. (HuGE Navigator)
19720893 Observational study of gene-disease association. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19707776 The aim of the present study was to determine the profile of mismatch repair (MMR) defects in Iranian colorectal cancer patients by using immunohistochemical staining for MLH1, MSH2, PMS2, and MSH6.
19697156 we functionally characterized 10 rare missense mutations in MLH1 and MSH2 identified in 13 Danish colorectal cancer families
19692168 Observational study of gene-disease association. (HuGE Navigator)
19685281 the mutation of c.1731+5G>A in MLH1 led to exon15 skipping, and that the mutation of c.211+1G>C in MSH2 created an activated cryptic splice-site 17-nucleotides upstream in exon1 in patients with Lynch syndrome
19669601 we present two large highly consanguineous HNPCC-families from Kuwait in whom a founder MSH2 mutation was identified
19669161 Studies indicate that none of the nine experimentally tested missense mutations in the MLH1 and MSH2 genes actually influenced splicing.
19639020 These results may point toward a role of MSH2 as a modifier for Neurofibromatosis type 1 (NF1), although the amount of DNA methylation and subsequent gene expression in other cell types of NF1 patients needs to be elucidated.
19635727 Women in this study had ovarian cancer, with either MLH1, MSH2 or MSH6 mutation. 30 year survival for ovarian cancer was 71.5%, and for all hereditary non-polyposis colon cancer (HNPCC)/Lynch syndrome related cancers inc. ovarian cancer it was 47.3%.
19635727 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622357 Observational study of gene-disease association. (HuGE Navigator)
19621725 microsatellite instability was associated with hMSH2 in gastric carcinomas
19621678 microsatellite instability in BAT26 and BAT25 were predictive of MSH2 mutated Lynch syndrome
19621678 Observational study of gene-disease association. (HuGE Navigator)
19582509 No correlation to nuclear microsatellite instability and allelic deletion of hMSH2, hMLH1, and p53 genes are associated with colorectal cancer.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19526325 Among patients with Lynch syndrome, germline defects were found in in MLH1 in 2 patients, in MSH2 in 4 patients, in PMS2 in 1 patient, and none in MSH6.
19526325 Observational study of gene-disease association. (HuGE Navigator)
19525234 MutSbeta displays identical biochemical and biophysical activities when interacting with a (CAG)(n) hairpin and a mismatch.[MutSbeta]
19486659 The MD simulations presented here offer first atomic-level insight into the structural changes in MSH2-MSH6 upon DNA binding and suggest, in particular, how such changes may result in the differential modulation of MSH2 and MSH6 ATPase activity
19464205 There were no statistical differences in the immunoexpression of the studied marker concerning gender, age strata, evolution course, tumor size, and location of the adenoma; several lesions showed complete absence of staining.
19423266 New hMSH2 missense mutation in Muir-Torre syndrome associated with familiar transmission of different gastrointestinal adenocarcinomas.
19419416 38 pathogenic mutations (10 large deletions and 28 point mutations or small deletion/insertions) in the MSH2 or MLH1 gene were identified in 61 of 93 Taiwanese Lynch syndrome families
19419416 Observational study of gene-disease association. (HuGE Navigator)
19418671 In South Africa, young black colorectal cancer patients were more likely to be male with poorly differentiated mucinous tumors and with loss of hMSH2 (mutS homolog 2) expression
19390556 Cerebral primitive neuroectodermal tumor in an adult with a heterozygous MSH2 mutation is reported.
19383374 REVIEW: mutations in mismatch repair genes, the most common of which are MSH2 and MLH1, which predispose to Lynch syndrome
19377479 The human DNA mismatch complex MSH2-MSH3 recognizes small loops by a mechanism different from that of MSH2-MSH6 for single-base mismatches.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19337631 Observational study of gene-disease association. (HuGE Navigator)
19291797 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19267393 Six programs were used to predict the effect of 13 MLH1 and 6 MSH2 gene variants on pre-mRNA splicing.
19254532 This study describes normal-mode calculations of MSH2-MSH6 with and without DNA; distinct conformational states are proposed for DNA scanning, mismatch recognition, repair initiation, and sliding along DNA after mismatch recognition.
19244167 Observational study of genetic testing. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19237577 a mismatch embedded in a nearest-neighbor sequence context containing symmetric 3'-purines (2 x 3'-purines) enhanced, whereas symmetric 3'-pyrimidines (2 x 3'-pyrimidines) reduced, hMSH2-hMSH6 ATPase activation.
19228687 the preferential processing of base-base and ID heteroduplexes by MutSalpha and MutSbeta is determined by their significant differences in ATPase activity, ADP binding activity, and high cellular MutSalpha:MutSbeta ratio
19215248 Observational study of gene-disease association. (HuGE Navigator)
19207881 Promoter hypermethylation was observed in 14/28 oral squamous cell carcinoma cases. Remarkably, 100% of patients with multiple oral malignancies showed hypermethylation in hMSH2.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19160096 Decreased MSH2 protein is associated with invasive squamous cell carcinoma of the vocal folds.
19132747 Observational study of gene-disease association. (HuGE Navigator)
19115210 Observational study of gene-disease association. (HuGE Navigator)
19100506 Three novel hereditray nonpolyposis colorectal cancer genes are reported in Korean families. MSH2 has a frameshift mutation and a premature stop codon.
19098912 Patients from Dutch and Chinese families with MSH2-deficient tumors carrying heterozygous germline deletions of the last exons of TACSTD1, a gene directly upstream of MSH2 encoding Ep-CAM, are described.
19075283 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19062740 Observational study of gene-disease association. (HuGE Navigator)
19034977 oncogenic bacterium H pylori may promote gastric carcinoma in part through effect on DNA MMR system (MLH1 and MSH2)
19032668 Our results indicate that promoter hypermethylation is an important mechanism for loss of hMLH1 and hMSH2 expression in human ovarian cancer and may be a potential prognostic factor in ovarian cancer.
18972272 Observational study of gene-disease association. (HuGE Navigator)
18955159 MSH2 is probably involved in the processing of the biologically significant clustered DNA damages as well as the execution of apoptosis induced by ionizing radiation.
18951462 MMR-deficient mutations situated in the amino-terminal connector and lever domains of MSH2 affected protein stability, whereas mutations in the ATPase domain caused defects in mismatch binding or release.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18949393 microsatellite instability Colorectal cancer patients with low Bcl-2 and hMLH1 and hMSH2 demonstrate a significantly shorter disease-free survival.
18931482 Observational study of gene-disease association. (HuGE Navigator)
18841495 Observational study of gene-disease association. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18822302 examined the consequences of seven MSH2 missense mutations found in hereditary nonpolyposis colorectal cancer families by testing the MSH2 mutant proteins in functional assays
18787700 MSH2 functions in DNA repair in response to DNA interstrand crosslinks.
18781619 MSH2 missense mutations in Hereditary Non-Polyposis Colorectal Cancer are described.
18781192 Study reports a 2 siblings with bi-allelic germline mutations in MSH2; a deletion of the first 6 exons and a variant of the initiation codon (c.1A>G), whereas their phenotypes are more suggestive of a mono-allelic pathogenic mismatch repair gene mutation.
18772310 SNP-based method for detecting LOH in MLH1 and MSH2 is simple to perform with instruments available in most clinical genetics laboratories
18761787 Expression of hMSH2 gene decreased gradually in 16HBE cells treated with CdCl2.
18759827 Observational study of genetic testing. (HuGE Navigator)
18726168 Observational study of gene-disease association. (HuGE Navigator)
18723338 Observational study of gene-disease association. (HuGE Navigator)
18713544 Eight hMSH2 or hMLH1 gene sequence variations were found in 12 Chinese families with hereditary nonpolyposis colorectal cancer (HNPCC).
18708397 Large genomic rearrangements were frequent in the MSH2 gene. Carriers and relatives have more extracolonic nonendometrial Lynch syndrome-associated cancers.
18708397 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18674656 gynecologic cancers, 88% of which (28 cases) were endometrial cancers, were diagnosed in 78.9% of the Ashkenazi families with the MSH2 A636P founder mutation and in 26.2% of the women who were at risk, with a mean age at diagnosis of 51.2 years
18646042 hMSH2 expression is associated with smoking status
18641418 Observational study of gene-disease association. (HuGE Navigator)
18635600 Data demonstrate a potential role for MSH2 in the pathogenesis of nonneoplastic mesenchymal cell accumulation and intestinal remodeling in Crohn's disease stricture formation.
18629513 A truncating mutation in the MSH2 gene, c.258_259delTG, was carried by patients developing cancer of the colon (two patients), uterus, kidney, bladder, and/or small intestine at ages 16, 24, 43, 44, 45, and 57, respectively.
18624996 Observational study of gene-disease association. (HuGE Navigator)
18623088 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18581137 In the normal tissues of hereditary non-polyposis colorectal cancer patients with MSH2 mutations, the MLH1/MSH2 transcript ratios were significantly elevated as compared to the ratios of normal mucosa in patients with MMR-proficient tumours.
18567801 Results indicate that the suppression of E2F1 transcriptional activity in senescent cells lead to stable repression of MSH2, followed by a induction of MutS alpha dysfunction, which results in a reduced DNA mismatch repair capacity in senescent cells.
18566915 there was large impact from recurrent mutations in MLH1 and MSH2 in Lynch syndrome
18561205 A total of 22 unclassified variants in the mismatch repair genes MLH1 and MSH2 involved in hereditary nonpolyposis colorectal cancer out of 85different variant alleles examined in 82 families affected splicing.
18554281 Observational study of gene-disease association. (HuGE Navigator)
18547406 High linkage disequilibrium in the genomic regions covering hMSH2, indicate that common genetic variants in general are not involved in the development of sporadic colorectal cancer
18547406 Observational study of gene-disease association. (HuGE Navigator)
18543228 The total mutation rate of hMLH1 and hMSH2 gene in Chinese and Korean hereditary nonpolyposis colorectal cancer was similar and lower than that reported in Western countries. But the mutation characteristics were different in the two populations.
18514060 These data indicate that MutSalpha associates with DNA non-specifically and forms an alpha-loop interaction with the DNA substrate.
18481196 Observational study of gene-disease association. (HuGE Navigator)
18470917 Uncertain pathogenicity of MSH2 variants N127S and G322D in genetic predisposition for colorectal, endometrial, pancreatic and biliary tract neoplasms.
18406877 Missense MSH2 gene mutation is associated with hereditary nonpolyposis colorectal cancer
18393252 The novel mutations c.243_244insA in MLH1 gene and c.1215_1218dupCCGA in MSH2 gene were the disease-causing mutations in the two HNPCC families.
18381419 Extensive genealogic studies have connected 27 of the 41 AFM of MSH2 families into seven extended pedigrees.
18364438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18335504 Re-annotation of the 10-Mb paracentric inversion of chromosome arm 2p that inactivates MSH2 and causes hereditary nonpolyposis colorectal cancer
18331286 MHL1 immunoexpression in both central/superficial and invasive tumor fronts of oral squamous cell carcinoma was not correlated with histological grades of malignancy.
18326858 interaction of the replication clamp with other repair protein(s) accounts for the essential role of PCNA in MutSalpha-dependent mismatch repair
18325052 loss of function of hMLH1 and hMSH2 is not involved in sporadic RCC, either by promoter methylation or mutation in their exons. LOH showed that chromosomal instability of large fragments of DNA was the main genetic alteration detected associated with RCC.
18325052 Observational study of gene-disease association. (HuGE Navigator)
18299982 The left-sided preponderance of DNA mismatch repair defective colorectal carcinomas was mostly associated with hMLH1, and with possible loss of hMSH2 expression.
18289827 In about 90-95% of the cases, germline mutations of the hMLH1 or hMSH2 genes can be demonstrated, while only a low percentage is caused by the mutations of hMSH6, hPMS1 and hPMS2.
18270343 Families who carried the c.942+3A>T MSH2 gene mutation had a higher frequency of Muir-Torre syndrome than families who carried other mutations in the MSH2 gene (75% vs 25%; P = .026).
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18265677 Expression of MSH2 protein was significantly lower in patients with gastric cancer showing a high frequency of microsatellite instability.
18265645 median MSH2 expression was lower in the presence of vascular invasion in the colorectal cacner patients.
18257912 Observational study of genotype prevalence. (HuGE Navigator)
18202787 These results support the evidence that hMSH2 and hMLH1 expression may increase prior to gastric cancer.
18186537 Observational study of genetic testing. (HuGE Navigator)
18181177 Deletion in the MSH2 gene is associated with Non-Hodgkin lymphoma related to hereditary nonpolyposis colorectal cancer
18091433 Observational study of gene-disease association. (HuGE Navigator)
18061181 Observational study of genetic testing. (HuGE Navigator)
18033691 Observational study of gene-disease association. (HuGE Navigator)
17987798 The lack of association between MSH2 protein expression and Microsatellite instability in endometrial cancer samples was observed
17982623 Protein MSH2 is involved in the regulation of normal cell cycle response after UVB-induced DNA damage.
17942459 Observational study of gene-disease association. (HuGE Navigator)
17942459 There is strong associations between the MSH2 -118T>C polymorphism and family history of CRC based on the Amsterdam criteria I (P = 0.005) and Amsterdam criteria I and II (P = 0.036)
17939062 Observational study of gene-disease association. (HuGE Navigator)
17922223 Extensive screening of 59 multiple-case breast cancer families did not identify any coding region mutations or larger genomic alterations in MSH2 that might implicate MSH2 as a breast cancer susceptibility gene.
17894833 tumors harboring the mutation lacked the expression of MSH2 and showed high microsatellite instability
17785078 Observational study of genotype prevalence. (HuGE Navigator)
17720936 missense mutations leading to loss of mismatch repair defined important structure-function relationships and the molecular analysis revealed the nature of the deficiency for Msh2 variants expressed in the tumors
17711772 an abnormal mismatch repair (one component of mismatch repair is MSH2 protein) may contribute to the carcinogenesis of a subset of laryngeal squamous cell carcinoma
17661183 Novel MSH2 mutation in a Druze family in Israel with a pedigree of HNPCC. The mutation was a c.702delA mutation in codon 234 of exon 4 that led to a premature stop in codon 245,p.
17653898 The researchers found four germline mutations associated with the clinical phenotype of Lynch syndrome
17652529 No loss of nuclear expression of either hMLH1 or hMSH2 was identified in any cases of intraductal or invasive ductal carcinoma, suggesting that hMLH1 or hMSH2 may not play an essential role in the majority of cases of the breast carcinoma.
17611581 MSH2 modulates in human melanocytes both UV-B-induced cell cycle regulation and apoptosis, most likely via independent, uncoupled mechanisms.
17601929 Familial T-cell non-Hodgkin lymphoma caused by biallelic MSH2 mutations.
17582678 Hereditary nonpolyposis colorectal cancer patients from Basque Country show higher percentages of MSH2 rearrangements than previously published by other authors.
17569143 Eighteen germline mutations (50%) were identified, 9 in MLH1 and 9 in MSH2, in Hungarian hereditary non-polyposis colorectal cancer (HNPCC) and suspected-HNPCC families.
17566596 the T/T genotype of hMSH2 gIVS12-6T>C polymorphism was a poor prognostic factor in non-small cell lung cancer
17566596 Observational study of gene-disease association. (HuGE Navigator)
17531106 Finds higher gene expression of MSH2 in responders and the trend for predicting overall survival indicates a predictive value of this marker in the treatment of advanced CRC with capecitabine
17505997 Observational study of gene-disease association. (HuGE Navigator)
17493242 Expression of hMSH2 and hMLH1 proteins was up-regulated in three cases, whereas in two cases that of hPMS2 was increased. hMSH6 expression was comparable to that of normal cells in all cases.
17483304 A need for caution in the use of radiotherapy for treatment of malignancies in individuals with functional loss of MSH2.
17479411 The expression levels of four genes (hMSH2, XRCC1, XPD, MGMT) present in peripheral blood mononuclear cells were significantly correlated with increased risk for esophageal squamous cell carcinoma.
17473388 Observational study of genetic testing. (HuGE Navigator)
17454882 Two to six percent of CRC are caused by germline mutation in the mismatch repair genes MLH1, MSH2 and MSH6.
17426439 MSH2 is required for signaling to the autophagic pathway after exposure to thioguanine.
17417778 Observational study of gene-disease association. (HuGE Navigator)
17414604 A636P mutations are found at increased frequency in Ashkenazim with a personal or family history of colorectal or other HNPCC-associated cancers
17407090 A novel duplication mutation of four nucleotides in exon 7 MSH2 (MSH2: c.1215_1218dupCCGA) was found in a large Chinese kindred with hereditary nonpolyposis colorectal cancer, which result in a premature stop 10 codons downstream in MSH2 in the family.
17351251 There is a substantial involvement of hMSH2 but little or no involvement of hMLH1 in the repair of UVA- and methylene-blue-plus-visible-light-induced oxidative DNA damage by base excision repair.
17350822 Observational study of gene-disease association. (HuGE Navigator)
17350822 findings suggest that mutations of p53 and hMSH2 genes may be deeply involved in not only the progression of hepatocellular carcinoma but also the recurrence development of hepatocellular carcinoma
17348456 Observational study of genotype prevalence. (HuGE Navigator)
17333219 Hreditary non-polyposis colorectal cancer in a Chinese family is associated with a novel mutation in the MSH2 gene.
17312306 Observational study of genetic testing. (HuGE Navigator)
17275176 Hypoxia induced coordinated repression of MLH1 and MSH2 leads to genetic instability and consequent tumor progression in cancer cells.
17259174 Bcl2 suppression of MMR may occur in a novel mechanism by directly regulating the heterodimeric hMSH2-hMSH6 complex, which potentially contributes to genetic instability and carcinogenesis
17250661 evidence of anticipation effects in HNPCC families carrying MSH2 deletions
17228328 Although the frequency is much lower than that of genomic deletions, there are partial gene duplications implicated in hereditary nonpolyposis colorectal cancer.
17224235 Observational study of gene-disease association. (HuGE Navigator)
17219447 Inactivation of MSH2 gene is associated with head and neck squamous cell carcinoma tumors and leukoplakia
17165155 All our patients carried the same novel MSH2 germline missense mutation (R359S) in exon 7. The mutation was associated with lack of expression of MSH2 protein and high microsatellite instability in tumour tissues.
17160686 In the inherited colon cancer syndrome hereditary non-polyposis colon cancer, microsatellite instability has been attributed to mutation in loci coding for hMSH2, wich is important redulators of the DNA mismatch repair system.
17139886 Observational study of gene-disease association. (HuGE Navigator)
17109103 In the inherited colon cancer syndrome hereditary non-polyposis colon cancer, microsatellite instability has been attributed to mutation in loci coding for hMSH2, wich is important redulators of the DNA mismatch repair system.
17095871 Observational study of genotype prevalence. (HuGE Navigator)
17051350 We report a case of Muir-Torre syndrome associated with intrahepatic cholangiocarcinoma, a location not previously described, and associated with a novel missense mutation of the MSH2 gene (c.2026T > C), predicted to disrupt the function of the gene.
17039271 The incidence of CRC in MSH2 mutation carriers, exposed to the same environment, is not modified by the specific mutation, although there is a suggestion that type of mutation may influence development of some extracolonic cancers.
17039269 We conclude that the high incidence of CRC in Newfoundland may be attributable to genetic, or at least familial, factors. In the high-risk families we provide evidence for the involvement of founder mutations in the APC and MSH2 genes.
17011982 Observational study of gene-disease association. (HuGE Navigator)
17011982 The odds ratio (OR) was 8.76 for CRC and 9.15 for GC, suggesting an association between the presence of variants in exon 7 of the MSH2 gene and risk of gastrointestinal cancer in the studied population
16995940 Missense mutations in MSH2 are likely to affect splicing only when located in weak alternative exons. When they do so, they might modulate in a tissue-specific manner cancer onset and its phenotypic manifestations.
16985024 Observational study of gene-disease association. (HuGE Navigator)
16940983 Observational study of gene-disease association. (HuGE Navigator)
16929514 Observational study of gene-disease association. (HuGE Navigator)
16918138 HMSH2 gene alterations associated with recurrence of oral squamous cell carcinoma
16908935 Observational study of gene-disease association. (HuGE Navigator)
16902769 The inactivation of the DNA-mismatch-repair-gene MSH2 and microsatellite instability may play a minor role in somatic colorectal cancer development.
16885385 Observational study of genetic testing. (HuGE Navigator)
16874859 Smoking promoted colorectal cancer in a dose-dependent manner in hMSH2 in males (P < 0.05). Females with hMSH2 mutations and both sexes with the hMLH1 groups only demonstrated a smoking effect after an extensive smoking history (P < 0.05).
16810763 Germline mutations of hMLH1 and hMSH2 genes are identified in about one-third hereditary nonpolyposis colorectal cancer (HNPCC) kindreds fulfilling Chinese HNPCC criteria.
16807412 Observational study of gene-disease association. (HuGE Navigator)
16786121 hMSH2 and hMLH1 may have a role in development of secondary carcinoma in the gastrointestinal tract in patients (stomach and colorectal carcinoma)
16774946 Observational study of gene-disease association. (HuGE Navigator)
16773692 Our study, probably for the first time, showed through immunohistochemical detection of hMSH2 and hMLH1 gene that DNA MMR system does not play a prominent role in liver fluke infection-associated cholangiocarcinogenesis.
16740762 Observational study of gene-disease association. (HuGE Navigator)
16696788 Observational study of genetic testing. (HuGE Navigator)
16684085 Study found that 40% of patients who were < or = 45 years of age at the time of diagnosis of colorectal cancer have tumors which are related to the absence of expression of either hMLH1 or hMSH2 genes.
16636019 Observational study of genotype prevalence. (HuGE Navigator)
16614121 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16569647 Microsatellite instability and modifications in the hMLH1 and hMSH2 genes are implicated in a significant proportion of the patients with head and neck cancer.
16541406 Alu is a promoting factor for the genomic recombinations in both MLH1 and MSH2, and the local Alu density may be involved in shaping the deletion pattern.
16500024 Mutation in MSH2 is associated with hereditary nonpolyposis colorectal cancer syndrome
16426918 results demonstrate that the loss of expression of MLH-1 and MSH-2 might play a role in the pathogenesis and/or malignant transformation in some renal carcinomas
16403449 biochemical analysis of the MutLalpha. MutSalpha complex
16353134 Observational study of gene-disease association. (HuGE Navigator)
16341550 Partial exon skipping was demonstrated for the mutations of MSH2 in hereditary nonpolyposis colorectal cancer patients.
16331552 Large DNA fragment aberrations of MSH2 gene was a frequent cause of Chinese HNPCC and CRC patients with family history.
16252083 Observational study of gene-disease association. (HuGE Navigator)
16252083 results indicate that Gly322 variant in the hMSH2 gene may increase the risk of breast cancer
16237223 Observational study of genetic testing. (HuGE Navigator)
16234028 A germline mutation of MSH2 gene could be found in patients with hereditary nonpolyposis colorectal cancer syndrome.
16203774 Observational study of gene-disease association. (HuGE Navigator)
16199548 the HNPCC associated MSH2*1906G-->C founder mutation probably arose between 11 and 22 generations ago
16143124 High frequency and diverse spectrum of large genomic alterations in hMSH2 in suspected Lynch syndrome patients
16116158 Observational study of gene-disease association. (HuGE Navigator)
16106253 Observational study of gene-disease association. (HuGE Navigator)
16106253 This study investigates microsatellite instability in multiple primary colorectal cancers, and the relevance of MLH1, MSH2, and MSH6 gene expression in hereditary nonpolyposis colon cancer.
16086322 the recombinogenic sequences in the MSH2 5' region may be involved in hereditary non-polyposis colorectal cancer
16061855 hMLH1 is the major altered mismatch repair gene involved in nonsmoking NSCLC tumorigenesis and promoter methylation is the predominant mechanism in hMLH1 and hMSH2 deregulation
16012876 No correlation between microsatellite instability and hMLH1, hMSH2 or P53 protein expression in basal cell carcinma was found.
16003840 Observational study of genotype prevalence. (HuGE Navigator)
15996210 We sequenced the MLH1/MSH2 coding and promoter core regions in patients with cancers suggestive of hereditary non-polyposis colorectal cancer, and correlated deleterious mutations with clinical and tumour features.
15959913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15952990 Observational study of genotype prevalence. (HuGE Navigator)
15904475 decreased expression in gastric mucosa during Helicobacter pylori gastritis
15886699 Tumor suppressor gene, hMSH2, may play an important role as a putative coactivator in ER alpha dependent gene expression.
15870899 There is increased expression of MSH2 in vulvar carcinoma neoplasms.
15862756 Observational study of gene-disease association. (HuGE Navigator)
15858146 Observational study of genetic testing. (HuGE Navigator)
15856462 hMSH2 PMS1 may be useful as CD4+ helper T cell antigens for immunotherapy of pancreatic cancer patients.
15855819 Defective DNA MMR is uncommon in long-term survivors of pancreatic cancer and does not account for the survival benefit in those with sporadic pancreatic cancer.
15849733 Observational study of genotype prevalence. (HuGE Navigator)
15832775 positive staining was found in 33.3% and 53.3% for hMLH1 and hMSH2, respectively, in dysplastic nevi, and in 54.5% and 69.1%, respectively, in cutaneous melanoma
15831578 Meta-analysis of genetic testing. (HuGE Navigator)
15816455 Colorectal cancers not expressing hMLH1 or hMSH2 may have distinct features from those expressing these mismatch repair proteins. p53 expression appears to be implicated in a compensatory pathway with mismatch repair proteins.
15808853 Results indicate that protein kinase C (PKC) zeta modulates hMutS alpha (MSH2, MSH6)stability and protein levels, and suggest a role for PKC zeta in genome stability by regulating mismatch repair activity.
15807307 Epithelial cells of CIN lesions showed a significant increase in the expression of both hMLH1 and hMSH2 proteins compared to non-neoplastic squamous epithelium.
15786548 Chinese hereditary nonpolyposis colorectal cancer showed relatively frequent germline mutation of mismatch repair (MMR) genes
15782118 BRAF mutations proved to be absent in tumors from hereditary nonpolyposis colorectal cancer syndrome (HNPCC) families with germline mutations in the MMR genes MLH1 and MSH2.
15774782 Observational study of healthcare-related. (HuGE Navigator)
15735976 hMLH1/hMSH2 protein expression is constitutively higher in certain cell types of certain tissues, including the majority of tissues that are at increased risk of cancer in hereditary non-polyposis colon cancer (HNPCC)
15713769 Observational study of genetic testing. (HuGE Navigator)
15696491 Large genomic deletions which mainly present to MSH2 account for 20% of general pathological sequence changes of MSH2 and MLH1 genes in Chinese HNPCC patients.
15613860 Observational study of genetic testing. (HuGE Navigator)
15596632 Observational study of gene-environment interaction. (HuGE Navigator)
15571801 A novel germ-line mutation in hereditary nonpolyposis colorectal cancer has been identified.
15527911 MSH2 Met688Ile and Leu390Phe are polymorphisms, not mutations, in the Japanese population
15523694 Observational study of gene-disease association. (HuGE Navigator)
15520370 Observational study of gene-disease association. (HuGE Navigator)
15503820 Clinicopathological data and patient survival were correlated with MSH2 staining
15467751 The expression of MSH2, MLH1 and Rad51 genes was clearly growth regulated
15467433 Loss of MSH2 gene is associated with genetic instability in testicular germ cell tumor
15467428 Downregulation of MSH2 protein is associated with breast disease
15375803 The caqrcinogenesis of hereditary form of colon cancer with mutations in hMLH1 and hMSH2 genes involved in DNA repair is reviewed.
15365996 In HPCC patients, 2 new frameshift mutations leading to premature stop codons were found in MSH2: c.1672delT (p.S558Xfs) and c.2466_2467delTG (p.C822X); and 1 new mutation leading to splice aberrations: c.1661G>C (r.1511_1661del).
15365995 2 new mutations (c.1886A>G, c.1316_1318delCCT)were found in Korean HNPCC families.
15350299 The first characterized nonepithelial tumors in hereditary nonpolyposis colorectal cancer seem to carry a limited panel of dna replication errors, including a frameshift at the MSH2 gene.
15342696 Observational study of genetic testing. (HuGE Navigator)
15340264 Observational study of gene-disease association. (HuGE Navigator)
15309712 Three of seven mutations have been found to be novel, and the germline G204X nonsense mutation in the third exon of hMSH2 has become the first MMR gene mutation found in Chinese Mongolian people.
15241839 Observational study of gene-disease association. (HuGE Navigator)
15216397 Low predictive value of hMLH2 microsatellite and immunohistochemical analysis in Taiwanese hereditary nonpolyposis colorectal cancer
15200905 hMSH2 gene mutations have been found in Chinese hereditary nonpolyposis colorectal cancer patients.
15161053 The presence of mutations of MSH2 and MLH1 in melanoma brain metastases, which has not been found in primary melanomas, indicates the high genomic instability of melanoma brain metastases.
15105434 MutSalpha has two nucleotide binding sites with differential specificities for ADP and ATP and the ADP.MutSalpha.ATP ternary complex has an important role in mismatch repair
15064730 hMSH2/6 formed a complex with BLM-p53-RAD51 in response to the damaged DNA forks during double-stranded break repair.
15063132 Novel germline hMSH2 genomic deletion and somatic hMSH2 mutations is associated with a hereditary nonpolyposis colorectal cancer family
15062061 All hereditary nonpolyposis colorectal cancer patients displayed microsatellite instability, with the half losing hMLH2 expression.
15043999 Data suggest that in human cell lines, ubiquitin-proteasome could play an important role in the regulation of hMutSalpha (hMSH2/hMSH6) protein expression, thereby regulating mismatch repair activity.
15043284 Observational study of gene-disease association. (HuGE Navigator)
15042510 Observational study of gene-disease association. (HuGE Navigator)
15042510 MSH2 c.1452-1455delAATG is a founder mutation and an important cause of hereditary nonpolyposis colorectal cancer in the southern Chinese population
15015769 Significantly higher expression of hMSH2 protein in glioblastoma multiforme. Implications of overexpression of hMSH2 in glioblastoma multiforme are not clear.
14961575 Observational study of gene-disease association. (HuGE Navigator)
14961575 Mutations of the MSH2 is associated with double primary cancers of the colorectum and the endometrium
14760534 findings suggest that defective DNA mismatch repair, due to inactivation of DNA mismatch repair protein hMLH1 and hMSH2 protein, does not play a significant role in the pathogenesis of intraductal papillary-mucinous neoplasms of the pancreas
14716824 4/6 (66.67%) and 1/6 (16.67%) mutations of hMSH2 and hMLH1 were identified in typical HNPCC and atypical HNPCC, respectively.
14714570 hMLH1 and hMSH2 gene mutations are present in radial growth-phase cutaneous malignant melanoma cell lines
14657349 A model in which MSH2 and ATR function upstream to regulate two branches of the response pathway to DNA damage caused by MNNG.
14645426 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14635101 Observational study of gene-disease association. (HuGE Navigator)
14631366 Loss of hMLH1 and/or hMSH2 expression was found in nine of 15 microsatellite instability-high ovarian endometrioid carcinomas.
14580774 Observational study of gene-disease association. (HuGE Navigator)
14580774 association between the polymorphism in exon 13 of the hMSH2 gene (gIVS 12-6T-->C) and the risk of non-Hodgkin lymphoma
14574163 Observational study of gene-disease association. (HuGE Navigator)
14562278 Inactivation of hMSH2 of DNA mismatch repair genes has an important role to play in the mutagenesis of the tumor-suppressor genes in alveolar soft part sarcoma.
14529665 Observational study of genetic testing. (HuGE Navigator)
14526391 colocalization of pathogenic missense mutations with exonic splicing enhancers sites strongly suggests that their pathogenic effects are splicing related
14500385 Data suggest direct involvement of MSH2 in processing IdUrd in DNA.
14499697 Germline mutations were found in 2 of 11 endometrial neoplasms without hereditary nonpolyposis colorectal cancer, but with family history.
12938096 Four different MSH2 deletions (exons 1-2, exons 1-6, exons 1-7 and exon 8) have been found in Lynch syndrome patients.
12930688 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12920342 Observational study of gene-disease association. (HuGE Navigator)
12912950 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12817878 Ductal pancreatic carcinomas express hMLH2 protein irrespective of their differentiation
12810667 hMSH2-deficient tumor cell lines did not accurately repair plasmid DNA double-strand breaks by homologous recombination. MSH2-deficiency could promote mutation caused by gene conversion which may also contribute to cancer predisposition.
12808326 Although mutator pathway was implicated in younger-age-onset colorectal carcinogenesis, many tumors appeared to evolve from different genetic events other than hMSH2 and hMLH1 mutations frequently identified in nonpolyposis colorectal cancer
12792735 Germline missense mutations in the hMSH2 gene is associated with sporadic colorectal cancer
12754350 msh2 expression was identified in recurrent glioblastoma multiforme
12712438 Our findings indicate that reduced expression of the MMR proteins may have an important contribution in the development of a subset of TCCs and suggest a potential role for MMR expression as prognostic indicators.
12697969 results indicated that the disruption of the mismatch repair system of Msh2 does not mainly lead to allelic loss of the FHIT/FRA3B locus as well as microsatellite instability in esophageal cancer
12688322 Observational study of gene-disease association. (HuGE Navigator)
12688322 A SNP [gIVS12-6T > C]in the MSH2 gene was found in 30 of 277 patients with lymphoma, leukemia & myelodysplasic syndromes. In lymphoma, the SNP frequency was 0.09, suggesting an association with the development of lymphomas.
12684691 Data show that alterations in global DNA methylation may influence tumor progression but are not directly associated with the inactivation of the mismatch-repair proteins hMLH1 and hMSH2.
12684669 Mutations of this protein show microsatellite instability in human prostatic cancer
12660027 Germline mutation in MSH2 exon 1, codon 61, nucleotide 181, stopping translation noted in one Uraguayan HNPCC family; and in another mutation at exon 3: at nucleotide 530, codon 117, causing frameshift and premature stop codon eight base pairs later
12658575 We identified a common deletion in MSH2, accounting for approximately 10% of our cohort of clinically selected North American families with HNPCC Genealogical, molecular, and haplotype studies showed that this deletion represents a founder mutation
12632492 Positive relationship between the expression of hMSH2 mRNA and the differentiated types of gastric cancer.
12627520 loss of MLH1 and MSH2 expression seen in approximately equal frequency in small intestine neoplasms with microsatellite instability
12622604 Observational study of genetic testing. (HuGE Navigator)
12595050 Observational study of genotype prevalence. (HuGE Navigator)
12595050 Although very rare in the population, MSH2*1906G>C is found at an increased frequency in young Jewish patients with colorectal cancer.
12582944 in glioblastoma multiforme patients expression of Msh2 is not related to age
12549480 Early onset brain tumor and lymphoma in MSH2-deficient children
12522549 Patients carry missense mutations in both MSH2 and MSH6.
12494471 genomic deletions in both MSH2 and MLH1 genes play a considerable role in the pathogenesis of HNPCC and should be part of the routine HNPCC mutation detection protocols.
12469220 mutation analysis of K-ras and beta-catenin genes related to O-6-methylguanine-DNA methyltransferase and this protein status in human gallbladder carcinoma
12454801 Observational study of genotype prevalence. (HuGE Navigator)
12454801 The founder mutation MSH2*1906G-->C is an important cause of hereditary nonpolyposis colorectal cancer in the Ashkenazi Jewish population
12419761 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, genetic testing, and healthcare-related. (HuGE Navigator)
12391284 Identification of transdominant-negative genetic suppressor elements derived from hMSH2 that mediate resistance to 6-thioguanine.
12203789 A 10-Mb paracentric inversion of chromosome arm 2p inactivates MSH2 and is responsible for hereditary nonpolyposis colorectal cancer in a North-American kindred.
12124176 Missense mutation in hMSH2 results in reduced hMSH2-hMSH6 dimers affecting mismatch-dependent molecular switch function in HNPCC
12095971 Two mutations and four polymorphisms detected in Brazilian families with suspected Hereditary Nonpolyposis Colorectal Cancer
12034830 Interactions between p53, hMSH2-hMSH6 and HMG I(Y) on Holliday junctions and bulged bases
11999575 The expression rates of the hMSH2, hMLH1 and hPMS1 genes were found to differ among various types of malignant lymphoproliferative disorders of B-cell origin, with higher incidence of gene expression aberrations associated with aggressive disease.
11920650 Observational study of gene-disease association. (HuGE Navigator)
11920468 expression changes during menstrual cycle in parallel with proliferative patients; expression in endometrial carcinoma consistent with PCNA expression
11910346 Observational study of genotype prevalence. (HuGE Navigator)
11890986 Observational study of gene-disease association. (HuGE Navigator)
11879922 Observational study of genetic testing. (HuGE Navigator)
11879922 Mutation analysis of MLH1 and MSH2 genes performed by denaturing high-performance liquid chromatography
11857745 Large deletions have been detected in MSH2 in hereditary nonpolyposis colorectal cancer (HNPCC).
11857301 differential expression associated with prostate carcinoma recurrence
11809883 hMutSalpha forms an ATP-dependent complex with hMutLalpha and hMutLbeta on DNA
11809679 A homozygous germ-line mutation in the human MSH2 gene predisposes to hematological malignancy and multiple cafe-au-lait spots.
11801590 interacts with MutY homolog
11782355 Observational study of gene-disease association. (HuGE Navigator)
11782355 Mutational analysis of promoters of mismatch repair genes hMSH2 and hMLH1 in hereditary nonpolyposis colorectal cancer and early onset colorectal cancer patients: identification of three novel germ-line mutations in promoter of the hMSH2 gene.
11756455 hMSH2-hMSH3 did not appear to bind any of the 8-oxo-G containing DNA substrates nor was there enhanced ATPase or ADP --> ATP exchange activities.
11748856 Further characterization of the mutational spectrum of MSH2 gene in HNPCC families.
11726306 Observational study of gene-disease association. (HuGE Navigator)
11606497 Observational study of gene-disease association. (HuGE Navigator)
11600610 Observational study of gene-disease association. (HuGE Navigator)
11579115 Observational study of genotype prevalence. (HuGE Navigator)
11562928 Observational study of genetic testing. (HuGE Navigator)
11524701 mutational analysis in HNPCC
11474654 hereditary and somatic mutations in sporadic endometrial adenocarcinoma
11208710 Observational study of genetic testing. (HuGE Navigator)
11158177 Observational study of gene-disease association. (HuGE Navigator)
11104559 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAVQPKETLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPA      1 - 70
GAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLAYKASPGNLSQFEDILFGNND     71 - 140
MSASIGVVGVKMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECVLPGGETAGDM    141 - 210
GKLRQIIQRGGILITERKKADFSTKDIYQDLNRLLKGKKGEQMNSAVLPEMENQVAVSSLSAVIKFLELL    211 - 280
SDDSNFGQFELTTFDFSQYMKLDIAAVRALNLFQGSVEDTTGSQSLAALLNKCKTPQGQRLVNQWIKQPL    281 - 350
MDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQA    351 - 420
LEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEK    421 - 490
KMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLN    491 - 560
EEYTKNKTEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQG    561 - 630
RIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESA    631 - 700
EVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYI    701 - 770
ATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHV    771 - 840
IECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQ    841 - 910
LKAEVIAKNNSFVNEIISRIKVTT                                                  911 - 934
//

Text Mined References (679)

PMID Year Title
27069191 2016 Causes of Cancer Death Among First-Degree Relatives in Japanese Families with Lynch Syndrome.
27013479 2016 Frequent mismatch-repair defects link prostate cancer to Lynch syndrome.
26728996 2016 Interdependence of DNA mismatch repair proteins MLH1 and MSH2 in apoptosis in human colorectal carcinoma cell lines.
26544533 2016 Constitutional Mismatch Repair Deficiency in Israel: High Proportion of Founder Mutations in MMR Genes and Consanguinity.
26498247 2016 A cryptic paracentric inversion of MSH2 exons 2-6 causes Lynch syndrome.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26477961 2015 Genomics of Hereditary Colorectal Cancer: Lessons Learnt from 25 Years of the Singapore Polyposis Registry.
26381082 2015 MSH2 role in BRCA1-driven tumorigenesis: A preliminary study in yeast and in human tumors from BRCA1-VUS carriers.
26224637 2015 Evidence that the DNA mismatch repair system removes 1-nucleotide Okazaki fragment flaps.
26221039 2015 Histone deacetylase 10 regulates DNA mismatch repair and may involve the deacetylation of MutS homolog 2.
26215063 2015 Mismatch repair gene expression in gastroesophageal cancers.
26212458 2015 The Mismatch-Binding Factor MutS? Can Mediate ATR Activation in Response to DNA Double-Strand Breaks.
26097592 2015 Relationship between MLH-1, MSH-2, PMS-2,MSH-6 expression and clinicopathological features in colorectal cancer.
26088318 2015 Up-regulation of MSH2, XRCC1 and ATM genes in patients with type 2 diabetes and coronary artery disease.
26053027 2015 Risk Factors Associated with Colorectal Cancer in a Subset of Patients with Mutations in MLH1 and MSH2 in Taiwan Fulfilling the Amsterdam II Criteria for Lynch Syndrome.
26025730 2015 Minor Changes in Expression of the Mismatch Repair Protein MSH2 Exert a Major Impact on Glioblastoma Response to Temozolomide.
25829401 2015 A First Step toward Personalized Medicine in Osteosarcoma: Pharmacogenetics as Predictive Marker of Outcome after Chemotherapy-Based Treatment.
25804231 2015 Polymorphism of DNA mismatch repair genes in endometrial cancer.
25664706 2015 Lymph node yield after colectomy for cancer: is absence of mismatch repair a factor?
25640028 2015 [Lynch syndrome and risk of prostate cancer; review of the literature].
25639900 2015 Exceptions to the rule: case studies in the prediction of pathogenicity for genetic variants in hereditary cancer genes.
25598504 2015 Association between genetic polymorphisms in DNA mismatch repair-related genes with risk and prognosis of head and neck squamous cell carcinoma.
25561800 2014 Comparative study of mutations in SNP loci of K-RAS, hMLH1 and hMSH2 genes in neoplastic intestinal polyps and colorectal cancer.
25560462 2015 Intronic and promoter polymorphisms of hMLH1/hMSH2 and colorectal cancer risk in Heilongjiang Province of China.
25503122 2014 Expression of MSH2 and MSH6 on a tissue microarray in patients with osteosarcoma.
25490383 2015 Down-regulation of MSH2 expression by Hsp90 inhibition enhances cytotoxicity affected by tamoxifen in human lung cancer cells.
25410477 2015 Characterization of complementary determinant region 3? in human MutS homologue 2-specific ?? T cells.
25255306 2014 Complex MSH2 and MSH6 mutations in hypermutated microsatellite unstable advanced prostate cancer.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25216868 2014 Clinicopathological and genetic features of Chinese hereditary nonpolyposis colorectal cancer (HNPCC).
25200962 2014 Molecular screening in Sicilian families with hereditary non-poliposis colorectal cancer (H.N.P.C.C.) syndrome: identification of a novel mutation in MSH2 gene.
25175513 2014 hMSH2 expression is associated with paclitaxel resistance in ovarian carcinoma, and inhibition of hMSH2 expression in vitro restores paclitaxel sensitivity.
25134804 2015 Gly322Asp and Asn127Ser single nucleotide polymorphisms (SNPs) of hMSH2 mismatch repair gene and the risk of triple-negative breast cancer in Polish women.
25133505 2014 The mutational spectrum of Lynch syndrome in cyprus.
25107687 2014 MLH1 and MSH2 mutation screening in HNPCC families of Hungary - Two new MMR gene mutations.
25106712 2014 A rare MSH2 mutation causes defective binding to hMSH6, normal hMSH2 staining, and loss of hMSH6 at advanced cancer stage.
25083964 2014 Immunohistochemical survey of mismatch repair protein expression in uterine sarcomas and carcinosarcomas.
24995467 2015 Expression of DNA mismatch repair proteins MLH1, MSH2, and MSH6 in recurrent glioblastoma.
24989436 2015 A review of mismatch repair gene transcripts: issues for interpretation of mRNA splicing assays.
24966277 2014 Crosstalk between BRCA-Fanconi anemia and mismatch repair pathways prevents MSH2-dependent aberrant DNA damage responses.
24933000 2014 Challenges in assessing pathogenicity based on frequency of variants in mismatch repair genes: an extreme case of a MSH2 variant and a meta-analysis.
24874052 2014 Expression of MLH1 and MSH2 in urothelial carcinoma of the renal pelvis.
24793746 2014 The prognostic significance of polymorphisms in hMLH1/hMSH2 for colorectal cancer.
24643686 2014 Immunohistochemical expression pattern of MMR protein can specifically identify patients with colorectal cancer microsatellite instability.
24612059 2014 Distinct profile of HIF1?, PTCH, EphB2, or DNA repair protein expression and BRAF mutation in colorectal serrated adenoma.
24530475 2014 Down-regulation of MSH2 expression by an Hsp90 inhibitor enhances pemetrexed-induced cytotoxicity in human non-small-cell lung cancer cells.
24501230 2014 Functional analysis of MSH2 unclassified variants found in suspected Lynch syndrome patients reveals pathogenicity due to attenuated mismatch repair.
24444820 2014 Mismatch repair protein expression in 1049 endometrial carcinomas, associations with body mass index, and other clinicopathologic variables.
24400091 2014 Promoter methylation of MLH1, PMS2, MSH2 and p16 is a phenomenon of advanced-stage HCCs.
24395779 2014 Mismatch repair protein hMSH2-hMSH6 recognizes mismatches and forms sliding clamps within a D-loop recombination intermediate.
24366688 2014 Promoter methylation status of MGMT, hMSH2, and hMLH1 and its relationship to corresponding protein expression and TP53 mutations in human esophageal squamous cell carcinoma.
24360395 Promoter hypermethylation of DNA repair genes MLH1 and MSH2 in adenocarcinomas and squamous cell carcinomas of the lung.
24333619 2014 Somatic mutations in MLH1 and MSH2 are a frequent cause of mismatch-repair deficiency in Lynch syndrome-like tumors.
24323032 2014 Tumor mismatch repair immunohistochemistry and DNA MLH1 methylation testing of patients with endometrial cancer diagnosed at age younger than 60 years optimizes triage for population-level germline mismatch repair gene mutation testing.
24317816 2014 Promoter methylation and immunohistochemical expression of hMLH1 and hMSH2 in sporadic colorectal cancer: a study from India.
24212987 Low expression of MSH2 DNA repair protein is associated with poor prognosis in head and neck squamous cell carcinoma.
24185125 2014 FHIT, EGFR, and MSH2: possible etiopathologic, prognostic, and predictive role in non-small cell lung carcinoma in Egyptian patients.
24141788 2014 YB-1 disrupts mismatch repair complex formation, interferes with MutS? recruitment on mismatch and inhibits mismatch repair through interacting with PCNA.
24122742 2013 Excess of extracolonic non-endometrial multiple primary cancers in MSH2 germline mutation carriers over MLH1.
24090359 2013 Functional examination of MLH1, MSH2, and MSH6 intronic mutations identified in Danish colorectal cancer patients.
24078570 2013 [Establishment of a hMSH2/hMSH6 protein interaction system and functional evaluation of hMSH2 gene missense mutations].
24073290 2013 Integrated analysis of mismatch repair system in malignant astrocytomas.
24039744 2013 Frequency and variability of genomic rearrangements on MSH2 in Spanish Lynch Syndrome families.
23990280 2014 Lynch Syndrome in high risk Ashkenazi Jews in Israel.
23904372 2013 MiR-21 mediates the radiation resistance of glioblastoma cells by regulating PDCD4 and hMSH2.
23865379 2013 Immunohistochemical analysis of mismatch proteins in carcinogenesis of the lower lip.
23817394 2013 Pattern of hMLH1, hMSH2 and hMSH6 expression and clinical characteristics in a sample of Malaysian colorectal carcinoma cases.
23794306 2012 Clinical and molecular characterization of colorectal cancer in young Moroccan patients.
23787767 2013 Reduced expression of mutS homolog 2 and mutL homolog 1 affects overall survival in laryngeal squamous cell carcinoma patients: Investigation into a potential cause.
23622243 2013 The histone mark H3K36me3 regulates human DNA mismatch repair through its interaction with MutS?.
23603115 2013 Ribonucleotides misincorporated into DNA act as strand-discrimination signals in eukaryotic mismatch repair.
23573243 2013 Novel DNA variants and mutation frequencies of hMLH1 and hMSH2 genes in colorectal cancer in the Northeast China population.
23526924 2013 Prevalence of pathological germline mutations of hMLH1 and hMSH2 genes in colorectal cancer.
23485110 2013 Cisplatin upregulates MSH2 expression by reducing miR-21 to inhibit A549 cell growth.
23434150 2013 Are the common genetic variants associated with colorectal cancer risk for DNA mismatch repair gene mutation carriers?
23401454 2013 Implementation of universal microsatellite instability and immunohistochemistry screening for diagnosing lynch syndrome in a large academic medical center.
23391514 Structural, molecular and cellular functions of MSH2 and MSH6 during DNA mismatch repair, damage signaling and other noncanonical activities.
23376256 2013 DNA mismatch repair protein MSH2 dictates cellular survival in response to low dose radiation in endometrial carcinoma cells.
23329266 2013 Splice site mutations in mismatch repair genes and risk of cancer in the general population.
23301373 2012 Status of mismatch repair genes hMSH2 and hMSH6 in colorectal cancer in Saudi patients: an immunohistochemical analysis.
23255516 2013 Cancer risks for MLH1 and MSH2 mutation carriers.
23231927 2012 MSH2 and CXCR4 involvement in malignant VIPoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23170986 2013 The MSH2 c.388_389del mutation shows a founder effect in Portuguese Lynch syndrome families.
23149851 2013 Outcome and status of microsatellite stability in Japanese atomic bomb survivors with early gastric carcinoma.
23143558 2012 Estradiol regulates miR-135b and mismatch repair gene expressions via estrogen receptor-? in colorectal cells.
23045530 2012 Engineered disulfide-forming amino acid substitutions interfere with a conformational change in the mismatch recognition complex Msh2-Msh6 required for mismatch repair.
22941650 2012 MutS? and histone deacetylase complexes promote expansions of trinucleotide repeats in human cells.
22883484 2013 Patients with Lynch syndrome mismatch repair gene mutations are at higher risk for not only upper tract urothelial cancer but also bladder cancer.
22865300 2013 hMSH2 and hMLH1 gene expression patterns differ between lung adenocarcinoma and squamous cell carcinoma: correlation with patient survival and response to adjuvant chemotherapy treatment.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22806311 2012 miR-21 induces cell cycle at S phase and modulates cell proliferation by down-regulating hMSH2 in lung cancer.
22781090 2013 A unique MSH2 exon 8 deletion accounts for a major portion of all mismatch repair gene mutations in Lynch syndrome families of Sardinian origin.
22776989 2012 Bethesda criteria for microsatellite instability testing: impact on the detection of new cases of Lynch syndrome.
22775459 2013 Impact of gynecological screening in Lynch syndrome carriers with an MSH2 mutation.
22739024 2012 The hMSH2(M688R) Lynch syndrome mutation may function as a dominant negative.
22669205 2012 Missense mutations in MLH1, MSH2, KRAS, and APC genes in colorectal cancer patients in Malaysia.
22635031 2012 Case-case study of factors associated to hMLH1, hMSH2, and hMSH6 protein expression among endometrial cancer patients of the University District Hospital of San Juan, Puerto Rico.
22614019 2013 The Grainyhead transcription factor Grhl3/Get1 suppresses miR-21 expression and tumorigenesis in skin: modulation of the miR-21 target MSH2 by RNA-binding protein DND1.
22581703 2012 Mismatch repair analysis of inherited MSH2 and/or MSH6 variation pairs found in cancer patients.
22493490 2012 Ectopic expression of human MutS homologue 2 on renal carcinoma cells is induced by oxidative stress with interleukin-18 promotion via p38 mitogen-activated protein kinase (MAPK) and c-Jun N-terminal kinase (JNK) signaling pathways.
22456432 2012 Expression of hMLH1, hMSH2 and hMSH6 in small intestinal carcinomas.
22453149 2012 Novel germline MLH1 and MSH2 mutations in Latvian Lynch syndrome families.
22433851 2012 Ectopically expressed human tumor biomarker MutS homologue 2 is a novel endogenous ligand that is recognized by human ?? T cells to induce innate anti-tumor/virus immunity.
22386861 2012 Polymorphisms in MSH2 gene and risk of gastric cancer, and interactions with lifestyle factors in a Chinese population.
22378480 2012 Mismatch repair proteins hMLH1 and hMSH2 are differently expressed in the three main subtypes of sporadic renal cell carcinoma.
22371642 2012 Germline mutation analysis of MLH1 and MSH2 in Malaysian Lynch syndrome patients.
22331944 2012 Colorectal and other cancer risks for carriers and noncarriers from families with a DNA mismatch repair gene mutation: a prospective cohort study.
22287095 2012 Loss of HLA class I and mismatch repair protein expression in sporadic endometrioid endometrial carcinomas.
22277660 2012 Biochemical analysis of the human mismatch repair proteins hMutS? MSH2(G674A)-MSH6 and MSH2-MSH6(T1219D).
22265839 2012 MSH2 promoter hypermethylation in circulating tumor DNA is a valuable predictor of disease-free survival for patients with esophageal squamous cell carcinoma.
22234160 2012 Association of genomic instability, and the methylation status of imprinted genes and mismatch-repair genes, with neural tube defects.
22219001 2012 The founder Ashkenazi Jewish mutations in the MSH2 and MSH6 genes in Israeli patients with gastric and pancreatic cancer.
22188959 [Prevalence of the expression of the MLH1 and MSH2 genes in colorectal serrated polyps and its correlation with morphological and cytoarchitectural characteristics].
22188021 2011 Challenges in the diagnosis and management of Lynch Syndrome in an Indigenous family living in a remote West Australian community.
22179786 2011 Mechanism of mismatch recognition revealed by human MutS? bound to unpaired DNA loops.
22173703 2012 Esophageal cancer risk is associated with polymorphisms of DNA repair genes MSH2 and WRN in Chinese population.
22164234 2011 Both hMutS? and hMutSß DNA mismatch repair complexes participate in 5-fluorouracil cytotoxicity.
22157815 2012 The SNF2-like helicase HELLS mediates E2F3-dependent transcription and cellular transformation.
22102614 2012 A rapid and cell-free assay to test the activity of lynch syndrome-associated MSH2 and MSH6 missense variants.
22086974 2012 Pathogenicity of A600V variant in exon 12 of the MSH2 gene detected in a Japanese kindred with Lynch syndrome.
22083523 2012 Predictive value of MGMT, hMLH1, hMSH2 and BRCA1 protein expression for pathological complete response to neoadjuvant chemotherapy in basal-like breast cancer patients.
22067334 2011 "Null pattern" of immunoreactivity in a Lynch syndrome-associated colon cancer due to germline MSH2 mutation and somatic MLH1 hypermethylation.
22017238 2012 DNA-repair gene variants are associated with glioblastoma survival.
21988782 2012 A meta-analysis of the prevalence of somatic mutations in the hMLH1 and hMSH2 genes in colorectal cancer.
21960445 2011 Conformational trapping of mismatch recognition complex MSH2/MSH3 on repair-resistant DNA loops.
21946537 2011 Somatic deletions of genes regulating MSH2 protein stability cause DNA mismatch repair deficiency and drug resistance in human leukemia cells.
21937421 2011 Human MSH2 (hMSH2) protein controls ATP processing by hMSH2-hMSH6.
21937259 2012 Immunoexpression of p53 and hMSH2 in oral squamous cell carcinoma and oral dysplastic lesions in Yemen: relationship to oral risk habits and prognostic factors.
21926548 2011 Pancreatic cancer and a novel MSH2 germline alteration.
21911971 2011 Mismatch repair genes expression defects & association with clinicopathological characteristics in colorectal carcinoma.
21855803 2011 The hMsh2-hMsh6 complex acts in concert with monoubiquitinated PCNA and Pol ? in response to oxidative DNA damage in human cells.
21821902 2011 Purification, crystallization and preliminary X-ray diffraction analysis of the human mismatch repair protein MutS?.
21778331 2011 Characterization of new founder Alu-mediated rearrangements in MSH2 gene associated with a Lynch syndrome phenotype.
21766496 Microsatellite instability and promoter hypermethylation of MLH1 and MSH2 in patients with sporadic colorectal cancer.
21744313 2012 Loss of expression of DNA mismatch repair proteins in aberrant crypt foci identified in vivo by magnifying colonoscopy in subjects with hereditary nonpolyposic and sporadic colon rectal cancer.
21732224 2011 Gene expression of the mismatch repair gene MSH2 in primary colorectal cancer.
21725088 2011 N-methyl-N'-nitro-N-nitrosoguanidine (MNNG) triggers MSH2 and Cdt2 protein-dependent degradation of the cell cycle and mismatch repair (MMR) inhibitor protein p21Waf1/Cip1.
21706233 2011 Promoter methylation status of hMLH1, hMSH2, and MGMT genes in colorectal cancer associated with adenoma-carcinoma sequence.
21681552 2011 Characterization of germline mutations of MLH1 and MSH2 in unrelated south American suspected Lynch syndrome individuals.
21674174 2011 Aberrant methylation of different DNA repair genes demonstrates distinct prognostic value for esophageal cancer.
21660619 2012 Clinical implications of mismatched repair gene promoter methylation in pancreatic cancer.
21642682 2011 Cancer risks associated with germline mutations in MLH1, MSH2, and MSH6 genes in Lynch syndrome.
21615986 2011 Distinct mutations in MLH1 and MSH2 genes in hereditary non-polyposis colorectal cancer (HNPCC) families from China.
21559014 2011 Body mass index in early adulthood and colorectal cancer risk for carriers and non-carriers of germline mutations in DNA mismatch repair genes.
21538690 2011 Deficiency in DNA mismatch repair increases the rate of telomere shortening in normal human cells.
21528083 2011 SPARCL1, Shp2, MSH2, E-cadherin, p53, ADCY-2 and MAPK are prognosis-related in colorectal cancer.
21513149 2010 [Association of mismatch repair gene polymorphism with susceptibility to sporadic colorectal cancer in Tianjin region].
21431882 2011 A putative Lynch syndrome family carrying MSH2 and MSH6 variants of uncertain significance-functional analysis reveals the pathogenic one.
21425258 2011 Promoter methylation and expression of MGMT and the DNA mismatch repair genes MLH1, MSH2, MSH6 and PMS2 in paired primary and recurrent glioblastomas.
21419771 2011 High risk of colorectal and endometrial cancer in Ashkenazi families with the MSH2 A636P founder mutation.
21419447 2011 Upper urinary tract carcinoma in Lynch syndrome cases.
21360204 2011 Mutation deep within an intron of MSH2 causes Lynch syndrome.
21358597 2011 Expression of DNA repair proteins MSH2, MLH1 and MGMT in human benign and malignant thyroid lesions: an immunohistochemical study.
21354521 2011 A novel nonsense mutation of MSH2 gene in a Taiwanese family with hereditary nonpolyposis colorectal cancer.
21348638 2011 Gene expression profile and mutational analysis of DNA mismatch repair genes in carcinoma prostate in Indian population.
21323960 2011 Immunohistochemical analysis of p53, APE1, hMSH2 and ERCC1 proteins in actinic cheilitis and lip squamous cell carcinoma.
21309037 2011 Characterization of MSH2 variants by endogenous gene modification in mouse embryonic stem cells.
21286667 2011 Molecular analysis of Fanconi anemia and mismatch repair genes in patients with colorectal carcinoma.
21285353 2011 hMSH2 recruits ATR to DNA damage sites for activation during DNA damage-induced apoptosis.
21269460 2011 Initial characterization of the human central proteome.
21156417 2010 A new mutation in the hMSH2 gene in a Spanish Lynch syndrome family.
21155023 2010 Racial differences in MLH1 and MSH2 mutation: an analysis of yellow race and white race based on the InSiGHT database.
21128252 2011 Association of low-risk MSH3 and MSH2 variant alleles with Lynch syndrome: probability of synergistic effects.
21122410 2010 [Expression and significance of mismatch repair genes hMLH1 and hMSH2 in sporadic colorectal carcinoma].
21120944 2011 Verification of the three-step model in assessing the pathogenicity of mismatch repair gene variants.
21093954 2011 Polymorphisms of MLH1 and MSH2 genes and the risk of lung cancer among never smokers.
21093899 2011 Endometrial cancer and genetic variation in PTEN, PIK3CA, AKT1, MLH1, and MSH2 within a population-based case-control study.
21091774 2010 Immunohistochemical expression of mismatch repair genes (hMSH2 and hMLH1) in hepatocellular carcinoma in Egypt.
21078976 2010 MicroRNA-21 induces resistance to 5-fluorouracil by down-regulating human DNA MutS homolog 2 (hMSH2).
21070872 2011 Rapid development of colorectal neoplasia in patients with Lynch syndrome.
21056691 2011 Prevalence of alterations in DNA mismatch repair genes in patients with young-onset colorectal cancer.
21047769 2010 Context-dependent bidirectional regulation of the MutS homolog 2 by transforming growth factor ? contributes to chemoresistance in breast cancer cells.
21034533 2010 Three novel germline mutations in MLH1 and MSH2 in families with Lynch syndrome living on Jeju island, Korea.
21029181 2011 Expression of DNA repair proteins, MSH2, MLH1 and MGMT in mobile tongue squamous cell carcinoma: associations with clinicopathological parameters and patients' survival.
20937110 2010 Screening of the DNA mismatch repair genes MLH1, MSH2 and MSH6 in a Greek cohort of Lynch syndrome suspected families.
20931542 2010 [Association of IVS10+12G>A polymorphism in hMSH2 gene with colorectal cancer in Chinese].
20872076 2011 Hereditary prostate cancer as a feature of Lynch syndrome.
20850175 2010 The rate of the predominant Jewish mutations in the BRCA1, BRCA2, MSH2 and MSH6 genes in unselected Jewish endometrial cancer patients.
20846263 2010 Epigenetic inactivation of HOXA5 and MSH2 gene in clear cell renal cell carcinoma.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20708344 2011 Association between genetic polymorphisms in the XRCC1, XRCC3, XPD, GSTM1, GSTT1, MSH2, MLH1, MSH3, and MGMT genes and radiosensitivity in breast cancer patients.
20672385 2010 Lynch syndrome-associated mutations in MSH2 alter DNA repair and checkpoint response functions in vivo.
20591884 2010 Risk of urothelial bladder cancer in Lynch syndrome is increased, in particular among MSH2 mutation carriers.
20564624 2010 Polymorphisms in ERCC2, MSH2, and OGG1 DNA repair genes and gallbladder cancer risk in a population of Northern India.
20505253 2010 Loss of hMSH2 gene expression correlates with improved survival in patients with sporadic colorectal cancer.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20495877 2010 Magnetic resonance colonography for colorectal cancer screening in patients with Lynch syndrome gene mutation.
20458443 2010 Polymorphisms in hMSH2 and hMLH1 and response to platinum-based chemotherapy in advanced non-small-cell lung cancer patients.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20438357 2010 Analysis of the hMSH2 gene variants in head and neck cancer.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
20388775 2010 Somatic hypermethylation of MSH2 is a frequent event in Lynch Syndrome colorectal cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373145 2010 Analysis of mismatch repair gene mutations in Turkish HNPCC patients.
20368715 2011 Tumor response is predicted by patient genetic profile in rectal cancer patients treated with neo-adjuvant chemo-radiotherapy.
20332274 2010 Effects of calcium and vitamin D on MLH1 and MSH2 expression in rectal mucosa of sporadic colorectal adenoma patients.
20305446 2010 Spectrum of MLH1 and MSH2 mutations in Chilean families with suspected Lynch syndrome.
20223108 2010 The expression of mismatch repair proteins MLH1, MSH2 and MSH6 correlates with the Ki67 proliferation index and survival in patients with recurrent glioblastoma.
20210238 Prognostic relevance of MLH1 and MSH2 mutations in hereditary non-polyposis colorectal cancer patients.
20206180 2010 One to 2-year surveillance intervals reduce risk of colorectal cancer in families with Lynch syndrome.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20181625 Molecular profiling using tissue microarrays as a tool to identify predictive biomarkers in laryngeal cancer treated with radiotherapy.
20160730 2010 MutSbeta exceeds MutSalpha in dinucleotide loop repair.
20154325 2010 MutLalpha and proliferating cell nuclear antigen share binding sites on MutSbeta.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20095990 2010 Founder effect of a pathogenic MSH2 mutation identified in Spanish families with Lynch syndrome.
20090515 2010 Immunophenotypic evaluation of DNA mismatch repair markers in 2 cases of synchronous histomorphologically distinct gastric adenocarcinomas with gastrointestinal stromal tumors of the proximal small bowel.
20072951 2009 Immunohistochemical analysis of hMLH1 and hMSH2 proteins in serous ovarian tumours.
20064472 2009 Nucleosome remodeling by hMSH2-hMSH6.
20056646 2010 Population-based study of the association of variants in mismatch repair genes with prostate cancer risk and outcomes.
20028567 2009 Cancer risk in MLH1, MSH2 and MSH6 mutation carriers; different risk profiles may influence clinical management.
20004149 2010 Nuclear reorganization of DNA mismatch repair proteins in response to DNA damage.
19950599 2009 [Expression and clinical significance of CDC6 and hMSH2 in cervical carcinoma].
19946888 2010 Defining the membrane proteome of NK cells.
19930554 2009 Partial loss of heterozygosity events at the mutated gene in tumors from MLH1/MSH2 large genomic rearrangement carriers.
19911012 2010 A novel complex mutation in MSH2 contributes to both Muir-Torre and Lynch Syndrome.
19900449 2010 Risk and epidemiological time trends of gastric cancer in Lynch syndrome carriers in the Netherlands.
19898223 2009 Endometrial carcinomas in women aged 40 years and younger: tumors associated with loss of DNA mismatch repair proteins comprise a distinct clinicopathologic subset.
19893772 2009 The identification of Lynch syndrome in British Columbia.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19876921 2010 CHEK2 mutations and HNPCC-related colorectal cancer.
19861671 2009 Risk of pancreatic cancer in families with Lynch syndrome.
19818066 2010 Expression of DNA mismatch repair proteins and MSH2 polymorphisms in nonmelanoma skin cancers of organ transplant recipients.
19760518 2009 A study on MSH2 and MLH1 mutations in hereditary nonpolyposis colorectal cancer families from the Basque Country, describing four new germline mutations.
19759184 2010 IVS10+12A>G polymorphism in hMSH2 gene associated with prognosis for patients with colorectal cancer.
19741564 2009 Effect of DNA repair host factors on temozolomide or dacarbazine melanoma treatment in Caucasians.
19734583 2009 [Clinicopathologic characteristics, diagnosis, and treatment of 30 patients with hereditary nonpolyposis colorectal cancer].
19728162 2009 Germline MLH1 and MSH2 mutations in Italian pancreatic cancer patients with suspected Lynch syndrome.
19723918 2009 Germ-line mutations in mismatch repair genes associated with prostate cancer.
19720893 2009 Ten years after mutation testing for Lynch syndrome: cancer incidence and outcome in mutation-positive and mutation-negative family members.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19707776 2010 Colorectal cancer in Iran: immunohistochemical profiles of four mismatch repair proteins.
19697156 2009 Functional characterization of rare missense mutations in MLH1 and MSH2 identified in Danish colorectal cancer patients.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19685281 2009 Determination of splice-site mutations in Lynch syndrome (hereditary non-polyposis colorectal cancer) patients using functional splicing assay.
19669601 2009 Impact of 226C>T MSH2 gene mutation on cancer phenotypes in two HNPCC-associated highly-consanguineous families from Kuwait: emphasis on premarital genetic testing.
19669161 2010 Comparative in silico analyses and experimental validation of novel splice site and missense mutations in the genes MLH1 and MSH2.
19639020 2010 Differential MSH2 promoter methylation in blood cells of Neurofibromatosis type 1 (NF1) patients.
19635727 2010 Survival in women with MMR mutations and ovarian cancer: a multicentre study in Lynch syndrome kindreds.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622357 2009 Calculation of risk of colorectal and endometrial cancer among patients with Lynch syndrome.
19621725 Analysis of microsatellite instability, protein expression and methylation status of hMLH1 and hMSH2 genes in gastric carcinomas.
19621678 Effectiveness of each Bethesda marker in defining microsatellite instability when screening for Lynch syndrome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19582509 2009 Mitochondrial genomic instability in colorectal cancer: no correlation to nuclear microsatellite instability and allelic deletion of hMSH2, hMLH1, and p53 genes, but prediction of better survival for Dukes' stage C disease.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19526325 2009 Screening for germline mutations of MLH1, MSH2, MSH6 and PMS2 genes in Slovenian colorectal cancer patients: implications for a population specific detection strategy of Lynch syndrome.
19525234 2009 Mismatch recognition protein MutSbeta does not hijack (CAG)n hairpin repair in vitro.
19486659 2009 Conformational change in MSH2-MSH6 upon binding DNA coupled to ATPase activity.
19464205 2009 Expression of hMLH1 and hMSH2 proteins in pleomorphic adenoma of minor salivary glands: relationship with clinical and histologic findings.
19423266 2009 A new mutation in Muir-Torre syndrome associated with familiar transmission of different gastrointestinal adenocarcinomas.
19419416 2009 Germ line MLH1 and MSH2 mutations in Taiwanese Lynch syndrome families: characterization of a founder genomic mutation in the MLH1 gene.
19418671 2009 Colorectal cancer in South Africa: a heritable cause suspected in many young black patients.
19390556 2009 Cerebral primitive neuroectodermal tumor in an adult with a heterozygous MSH2 mutation.
19383374 2009 Hereditary ovarian carcinoma: heterogeneity, molecular genetics, pathology, and management.
19377479 2009 The nucleotide binding dynamics of human MSH2-MSH3 are lesion dependent.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19337631 2009 Introduction of cytogenetic tests in colorectal cancer screening.
19291797 2009 Haemochromatosis HFE gene polymorphisms as potential modifiers of hereditary nonpolyposis colorectal cancer risk and onset age.
19267393 2009 Classifying MLH1 and MSH2 variants using bioinformatic prediction, splicing assays, segregation, and tumor characteristics.
19254532 2009 Deciphering the mismatch recognition cycle in MutS and MSH2-MSH6 using normal-mode analysis.
19244167 2009 Prediction of Lynch syndrome in consecutive patients with colorectal cancer.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19237577 2009 Sequence context effect for hMSH2-hMSH6 mismatch-dependent activation.
19228687 2009 Distinct nucleotide binding/hydrolysis properties and molar ratio of MutSalpha and MutSbeta determine their differential mismatch binding activities.
19215248 2009 Cumulative lifetime incidence of extracolonic cancers in Lynch syndrome: a report of 121 families with proven mutations.
19207881 2009 Promoter hypermethylation of mismatch repair genes, hMLH1 and hMSH2 in oral squamous cell carcinoma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19160096 2009 Analysis of hMSH2 mismatch repair protein expression in dysplasia, carcinoma in situ and invasive squamous cell carcinoma of the vocal folds.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19132747 2009 PMS2 involvement in patients suspected of Lynch syndrome.
19115210 2009 Common germline variation in mismatch repair genes and survival after a diagnosis of colorectal cancer.
19100506 2009 Three new nonsense mutations of MLH1 and MSH2 genes in Korean families with hereditary nonpolyposis colorectal cancer.
19098912 2009 Heritable somatic methylation and inactivation of MSH2 in families with Lynch syndrome due to deletion of the 3' exons of TACSTD1.
19075283 2009 Role for genetic anticipation in Lynch syndrome.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19062740 2008 [Mutation of hMLH1 and hMSH2 genes in hereditary nonpolyposis colorectal cancer: analysis of 76 probands].
19034977 2008 Helicobacter pylori infection and expression of DNA mismatch repair proteins.
19032668 2008 Expression and promoter methylation status of mismatch repair gene hMLH1 and hMSH2 in epithelial ovarian cancer.
18972272 2008 Risk of gynecologic cancers in Danish hereditary non-polyposis colorectal cancer families.
18955159 2009 Compromised repair of clustered DNA damage in the human acute lymphoblastic leukemia MSH2-deficient NALM-6 cells.
18951462 2008 Mechanisms of pathogenicity in human MSH2 missense mutants.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18949393 2008 Oncoprotein Bcl-2 and microsatellite instability are associated with disease-free survival and treatment response in colorectal cancer.
18931482 2008 Mismatch repair gene mutations in Chinese HNPCC patients.
18841495 2009 High risk of endometrial cancer in colorectal cancer kindred is pathognomonic for MMR-mutation carriers.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18822302 2008 Functional analysis of HNPCC-related missense mutations in MSH2.
18787700 2008 Human MLH1 protein participates in genomic damage checkpoint signaling in response to DNA interstrand crosslinks, while MSH2 functions in DNA repair.
18781619 2008 MSH2 missense mutations and HNPCC syndrome: pathogenicity assessment in a human expression system.
18781192 2009 Compound heterozygosity for two MSH2 mutations suggests mild consequences of the initiation codon variant c.1A>G of MSH2.
18772310 2008 Multiplex SNaPshot genotyping for detecting loss of heterozygosity in the mismatch-repair genes MLH1 and MSH2 in microsatellite-unstable tumors.
18761787 2008 [Expression and sequence analysis of human MutS homologue 2 during different stages of human bronchial epithelial cells induced by cadmium chloride].
18759827 2008 Identification in daily practice of patients with Lynch syndrome (hereditary nonpolyposis colorectal cancer): revised Bethesda guidelines-based approach versus molecular screening.
18726168 2009 Recurring MLH1 deleterious mutations in unrelated Chinese Lynch syndrome families in Singapore.
18723338 2008 Mismatch repair gene polymorphisms and survival in invasive ovarian cancer patients.
18713544 2008 Clinical features and hMSH2/hMLH1 germ-line mutations in Chinese patients with hereditary nonpolyposis colorectal cancer.
18708397 2008 Phenotype comparison of MLH1 and MSH2 mutation carriers in a cohort of 1,914 individuals undergoing clinical genetic testing in the United States.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18675275 2008 The novel protein complex with SMARCAD1/KIAA1122 binds to the vicinity of TSS.
18674656 2008 Gynecologic malignancies in Ashkenazi families with the MSH2 A636P founder mutation.
18646042 2008 Expression of mismatch repair proteins, hMLH1/hMSH2, in non-small cell lung cancer tissues and its clinical significance.
18641418 2008 DNA repair polymorphisms and the risk of stomach adenocarcinoma and severe chronic gastritis in the EPIC-EURGAST study.
18635600 2008 Role of MutS homolog 2 (MSH2) in intestinal myofibroblast proliferation during Crohn's disease stricture formation.
18629513 2008 Report of a family segregating mutations in both the APC and MSH2 genes: juvenile onset of colorectal cancer in a double heterozygote.
18625694 2008 A high incidence of MSH6 mutations in Amsterdam criteria II-negative families tested in a diagnostic setting.
18624996 2008 Molecular epidemiological and mutational analysis of DNA mismatch repair (MMR) genes in endometrial cancer patients with HNPCC-associated familial predisposition to cancer.
18623088 2008 IGF1 is a modifier of disease risk in hereditary non-polyposis colorectal cancer.
18581137 2008 Reduced mRNA expression in paraffin-embedded tissue identifies MLH1- and MSH2-deficient colorectal tumours and potential mutation carriers.
18567801 2008 Senescence-dependent MutS alpha dysfunction attenuates mismatch repair.
18566915 2009 Major contribution from recurrent alterations and MSH6 mutations in the Danish Lynch syndrome population.
18561205 2008 A large fraction of unclassified variants of the mismatch repair genes MLH1 and MSH2 is associated with splicing defects.
18554281 2008 Colorectal cancer in HNPCC: cumulative lifetime incidence, survival and tumour distribution. A report of 121 families with proven mutations.
18547406 2008 The association between genetic variants in hMLH1 and hMSH2 and the development of sporadic colorectal cancer in the Danish population.
18543228 2008 [Comparison of clinical and genetic phenotypes between Chinese and Korean hereditary nonpolyposis colorectal cancer families].
18514060 2008 Alpha-shaped DNA loops induced by MutS.
18481196 2008 Higher occurrence of childhood cancer in families with germline mutations in BRCA2, MMR and CDKN2A genes.
18470917 2008 Uncertain pathogenicity of MSH2 variants N127S and G322D challenges their classification.
18406877 2008 A novel missense MSH2 gene mutation in a patient of a Korean family with hereditary nonpolyposis colorectal cancer.
18393252 2008 [Mutation screening of MLH1 and MSH2 genes in two Chinese families with hereditary nonpolyposis colorectal cancer].
18381419 2008 Origins and prevalence of the American Founder Mutation of MSH2.
18364438 2008 Common variants in mismatch repair genes and risk of colorectal cancer.
18335504 2008 The 10-Mb paracentric inversion of chromosome arm 2p in activating MSH2 and causing hereditary nonpolyposis colorectal cancer: re-annotation and mutational mechanisms.
18331286 2008 Immunoexpression of hMSH2 and hMLH1 in oral squamous cell carcinoma and its relationship to histological grades of malignancy.
18326858 2008 The MutSalpha-proliferating cell nuclear antigen interaction in human DNA mismatch repair.
18325052 2008 Implications of mismatch repair genes hMLH1 and hMSH2 in patients with sporadic renal cell carcinoma.
18299982 2008 Sporadic colon cancer: mismatch repair immunohistochemistry and microsatellite instability in Omani subjects.
18289827 2008 Difficulties in recognizing families with Hereditary Non-polyposis Colorectal Carcinoma. Presentation of 4 families with proven mutation.
18270343 2008 The frequency of Muir-Torre syndrome among Lynch syndrome families.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18265677 2007 MSI is frequently recognized among gastric cancer patients with a family history of cancer.
18265645 2007 Mismatch repair protein MSH2, cytokeratin 18 and cytokeratin 20 expression: clinicopathological correlation and prognostic value in colorectal cancer patients.
18257912 2008 Detection of mismatch repair gene germline mutation carrier among Chinese population with colorectal cancer.
18202787 2008 Overexpression of hMSH2 and hMLH1 protein in certain gastric cancers and their surrounding mucosae.
18186537 2008 Single nucleotide polymorphism detection in the hMSH2 gene using conformation-sensitive CE.
18181177 2008 Non-Hodgkin lymphoma related to hereditary nonpolyposis colorectal cancer in a patient with a novel heterozygous complex deletion in the MSH2 gene.
18091433 2007 Heterogeneous molecular mechanisms underlie attenuated familial adenomatous polyposis.
18061181 2008 Validation and extension of the PREMM1,2 model in a population-based cohort of colorectal cancer patients.
18033691 2008 Classification of ambiguous mutations in DNA mismatch repair genes identified in a population-based study of colorectal cancer.
17987798 2007 Microsatellite instability (MSI) and MLH1 and MSH2 protein expression analysis in postmenopausal women with sporadic endometrial cancer.
17982623 2007 Non-tumor cells from an MSH2-null individual show altered cell cycle effects post-UVB.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17942459 2007 MSH2 118T>C and MSH6 159C>T promoter polymorphisms and the risk of colorectal cancer.
17939062 2008 Gene-related cancer spectrum in families with hereditary non-polyposis colorectal cancer (HNPCC).
17922223 2008 Is MSH2 a breast cancer susceptibility gene?
17894833 2007 Germline hMSH2 promoter mutation in a Chinese HNPCC kindred: evidence for dual role of LOH.
17785078 2007 [Screening the hereditary nonpolyposis colorectal cancer by revised Bethesda guideline: a cohort study of 110 cases].
17720936 2007 Functional characterization of pathogenic human MSH2 missense mutations in Saccharomyces cerevisiae.
17715146 2007 Physical and functional interactions between Werner syndrome helicase and mismatch-repair initiation factors.
17711772 2007 Significance and mechanism of microsatellite instability in laryngeal squamous cell carcinoma.
17661183 2008 A novel MSH2 germline mutation in a Druze HNPCC family.
17653898 2007 Nine novel pathogenic germline mutations in MLH1, MSH2, MSH6 and PMS2 in families with Lynch syndrome.
17652529 2007 Mismatch repair genes hMLH1 and hMSH2 may not play an essential role in breast carcinogenesis.
17611581 2008 The DNA-mismatch repair enzyme hMSH2 modulates UV-B-induced cell cycle arrest and apoptosis in melanoma cells.
17601929 2007 Familial T-cell non-Hodgkin lymphoma caused by biallelic MSH2 mutations.
17582678 2007 High proportion of large genomic rearrangements in hMSH2 in hereditary nonpolyposis colorectal cancer (HNPCC) families of the Basque Country.
17569143 2007 Germline MLH1 and MSH2 mutational spectrum including frequent large genomic aberrations in Hungarian hereditary non-polyposis colorectal cancer families: implications for genetic testing.
17566596 2007 Polymorphism in the hMSH2 gene (gISV12-6T > C) is a prognostic factor in non-small cell lung cancer.
17531815 2007 Structure of the human MutSalpha DNA lesion recognition complex.
17531106 2007 Predictive value of MSH2 gene expression in colorectal cancer treated with capecitabine.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17505997 2007 Genotype-phenotype correlations in individuals with a founder mutation in the MLH1 gene and hereditary non-polyposis colorectal cancer.
17493242 2007 DNA mismatch repair protein expression and microsatellite instability in primary mucosal melanomas of the head and neck.
17483304 2007 Biallelic mutation of MSH2 in primary human cells is associated with sensitivity to irradiation and altered RAD51 foci kinetics.
17479411 2007 Reduced expression of human DNA repair genes in esophageal squamous-cell carcinoma in china.
17473388 2007 A mononucleotide markers panel to identify hMLH1/hMSH2 germline mutations.
17454882 2007 Prevention of colorectal cancer by colonoscopic surveillance in families with hereditary colorectal cancer.
17426439 A novel role for DNA mismatch repair and the autophagic processing of chemotherapy drugs in human tumor cells.
17417778 2007 Genetic investigation of DNA-repair pathway genes PMS2, MLH1, MSH2, MSH6, MUTYH, OGG1 and MTH1 in sporadic colon cancer.
17414604 2007 Single-amplicon MSH2 A636P mutation testing in Ashkenazi Jewish patients with colorectal cancer: role in presurgical management.
17407090 2007 [Familial and genetic study in a large Chinese kindred with hereditary nonpolyposis colorectal cancer].
17367211 2007 Deletion of complement factor H-related genes CFHR1 and CFHR3 is associated with atypical hemolytic uremic syndrome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17351251 2007 Reduced host cell reactivation of oxidative DNA damage in human cells deficient in the mismatch repair gene hMSH2.
17350822 2007 Prognosis in patients with hepatocellular carcinoma correlates to mutations of p53 and/or hMSH2 genes.
17348456 Nationwide study of clinical and molecular features of hereditary non-polyposis colorectal cancer (HNPCC) in Latvia.
17333219 2007 A novel MSH2 mutation in a Chinese family with hereditary non-polyposis colorectal cancer.
17312306 2007 Lynch syndrome (hereditary nonpolyposis colorectal cancer) diagnostics.
17275176 2007 Co-repression of mismatch repair gene expression by hypoxia in cancer cells: role of the Myc/Max network.
17259174 2007 Bcl2 impedes DNA mismatch repair by directly regulating the hMSH2-hMSH6 heterodimeric complex.
17250661 2007 Germline novel MSH2 deletions and a founder MSH2 deletion associated with anticipation effects in HNPCC.
17228328 2007 Partial duplications of the MSH2 and MLH1 genes in hereditary nonpolyposis colorectal cancer.
17224235 2007 The additive effect of p53 Arg72Pro and RNASEL Arg462Gln genotypes on age of disease onset in Lynch syndrome patients with pathogenic germline mutations in MSH2 or MLH1.
17219447 2007 Inactivation of human mutL homolog 1 and mutS homolog 2 genes in head and neck squamous cell carcinoma tumors and leukoplakia samples by promoter hypermethylation and its relation with microsatellite instability phenotype.
17165155 2007 A missense germline mutation in exon 7 of the MSH2 gene in a HNPCC family from center-Italy.
17160686 2007 Assessment of microsatellite instability in colorectal carcinoma at an Indian center.
17139886 2006 The T/G mutation in exon 8 of hMSH2 gene in the sporadic colon cancer patients.
17128465 2006 Gene symbol: msh2. Disease: hereditary nonpolyposis colorectal cancer.
17109103 2007 The role of chemotherapy in microsatellite unstable (MSI-H) colorectal cancer.
17101317 2006 Pathogenicity of MSH2 missense mutations is typically associated with impaired repair capability of the mutated protein.
17095871 2006 Frequency of hereditary non-polyposis colorectal cancer among unselected patients with colorectal cancer in Germany.
17080293 2006 The role of the human DNA mismatch repair gene hMSH2 in DNA repair, cell cycle control and apoptosis: implications for pathogenesis, progression and therapy of cancer.
17076561 2006 Atypical haemolytic uraemic syndrome associated with a hybrid complement gene.
17051350 2007 A case of Muir-Torre syndrome associated with mucinous hepatic cholangiocarcinoma and a novel germline mutation of the MSH2 gene.
17039271 2007 The phenotypic expression of three MSH2 mutations in large Newfoundland families with Lynch syndrome.
17039269 2007 Very high incidence of familial colorectal cancer in Newfoundland: a comparison with Ontario and 13 other population-based studies.
17011982 2006 Variations in exon 7 of the MSH2 gene and susceptibility to gastrointestinal cancer in a Chinese population.
16995940 2006 In silico and in vivo splicing analysis of MLH1 and MSH2 missense mutations shows exon- and tissue-specific effects.
16985024 2006 Endometrial cancer risk is associated with variants of the mismatch repair genes MLH1 and MSH2.
16951290 2006 EASI--enrichment of alternatively spliced isoforms.
16940983 2006 MSH6 germline mutations in early-onset colorectal cancer patients without family history of the disease.
16929514 2006 Germline mutations and polymorphic variants in MMR, E-cadherin and MYH genes associated with familial gastric cancer in Jiangsu of China.
16918138 2006 HMSH2 gene alterations associated with recurrence of oral squamous cell carcinoma.
16908935 2006 Genotype-phenotype comparison of German MLH1 and MSH2 mutation carriers clinically affected with Lynch syndrome: a report by the German HNPCC Consortium.
16902769 2007 Novel hMSH2, hMSH6 and hMLH1 gene mutations and microsatellite instability in sporadic colorectal cancer.
16885385 2006 Screening for Lynch syndrome (hereditary nonpolyposis colorectal cancer) among endometrial cancer patients.
16874859 2006 Risk of colon cancer in hereditary non-polyposis colorectal cancer patients as predicted by fuzzy modeling: Influence of smoking.
16810763 2006 Clinical and genetic characteristics of Chinese hereditary nonpolyposis colorectal cancer families.
16807412 2006 Identification and survival of carriers of mutations in DNA mismatch-repair genes in colon cancer.
16786121 2006 Loss of protein expression of hMLH1 and hMSH2 with double primary carcinomas of the stomach and colorectum.
16774946 2006 Common variants in mismatch repair genes and risk of invasive ovarian cancer.
16773692 2006 Immunohistochemical expression of mismatch repair genes: a screening tool for predicting mutator phenotype in liver fluke infection-associated intrahepatic cholangiocarcinoma.
16740762 2006 Germ line mutations of mismatch repair genes in hereditary nonpolyposis colorectal cancer patients with small bowel cancer: International Society for Gastrointestinal Hereditary Tumours Collaborative Study.
16713580 2006 ATR kinase activation mediated by MutSalpha and MutLalpha in response to cytotoxic O6-methylguanine adducts.
16696788 2006 Clinical performance of original and revised Bethesda guidelines for the identification of MSH2/MLH1 gene carriers in patients with newly diagnosed colorectal cancer: proposal of a new and simpler set of recommendations.
16684085 2006 Immunohistochemistry detects mismatch repair gene defects in colorectal cancer.
16636019 2006 Identification of mismatch repair gene mutations in young patients with colorectal cancer and in patients with multiple tumours associated with hereditary non-polyposis colorectal cancer.
16614121 2006 Polymorphisms in the hMSH2 gene and the risk of primary lung cancer.
16569647 2006 Microsatellite instability and methylation of the DNA mismatch repair genes in head and neck cancer.
16541406 2006 Distinct patterns of germ-line deletions in MLH1 and MSH2: the implication of Alu repetitive element in the genetic etiology of Lynch syndrome (HNPCC).
16500024 2006 New founding mutation in MSH2 associated with hereditary nonpolyposis colorectal cancer syndrome on the Island of Tenerife.
16451135 2006 Germline MSH2 and MLH1 mutational spectrum including large rearrangements in HNPCC families from Poland (update study).
16426918 2006 Mismatch repair genes in renal cortical neoplasms.
16403449 2006 Analysis of the human MutLalpha.MutSalpha complex.
16388310 2006 Transcription promotes contraction of CAG repeat tracts in human cells.
16372347 2006 A novel MSH2 germline mutation in homozygous state in two brothers with colorectal cancers diagnosed at the age of 11 and 12 years.
16353134 2006 Age of diagnosis of colorectal cancer in HNPCC patients is more complex than that predicted by R72P polymorphism in TP53.
16341550 2006 Aberrant splicing in MLH1 and MSH2 due to exonic and intronic variants.
16331552 2005 The analysis for identifying large DNA fragment aberrations of MSH2 and MLH1 genes from familial colorectal cancer in China.
16252083 2005 Polymorphisms of the DNA mismatch repair gene HMSH2 in breast cancer occurence and progression.
16237223 2005 Assay validation for identification of hereditary nonpolyposis colon cancer-causing mutations in mismatch repair genes MLH1, MSH2, and MSH6.
16234028 2005 Chromoendoscopic colonoscopy for detecting preneoplastic lesions in hereditary nonpolyposis colorectal cancer syndrome.
16203774 2005 High frequency of hereditary colorectal cancer in Newfoundland likely involves novel susceptibility genes.
16199548 2005 The HNPCC associated MSH2*1906G-->C founder mutation probably originated between 1440 CE and 1715 CE in the Ashkenazi Jewish population.
16143124 2005 Characterization of hMLH1 and hMSH2 gene dosage alterations in Lynch syndrome patients.
16116158 2005 Use of molecular tumor characteristics to prioritize mismatch repair gene testing in early-onset colorectal cancer.
16106253 2005 The role of MLH1, MSH2 and MSH6 in the development of multiple colorectal cancers.
16086322 2005 The 5' region of the MSH2 gene involved in hereditary non-polyposis colorectal cancer contains a high density of recombinogenic sequences.
16061855 2005 Promoter hypermethylation is the predominant mechanism in hMLH1 and hMSH2 deregulation and is a poor prognostic factor in nonsmoking lung cancer.
16051665 2005 Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes.
16012876 2005 Expression of mismatch repair enzymes, hMLH1 and hMSH2 is not associated with microsatellite instability and P53 protein accumulation in basal cell carcinoma.
16003840 2005 Genomic rearrangements in MSH2 and MLH1 are rare mutational events in Spanish patients with hereditary nonpolyposis colorectal cancer.
15996210 2005 Clinical and molecular characteristics of hereditary non-polyposis colorectal cancer families in Southeast Asia.
15991316 2005 Gene symbol: MSH2. Disease: Hereditary nonpolyposis colorectal cancer.
15959913 2005 Clinical and genetic findings in an Ashkenazi Jewish population with colorectal neoplasms.
15952990 2005 Frequency of hereditary non-polyposis colorectal cancer among Uruguayan patients with colorectal cancer.
15904475 2005 Effect of Helicobacter pylori infection on the expression of DNA mismatch repair protein.
15896463 2005 A novel missense germline mutation in exon 2 of the hMSH2 gene in a HNPCC family from Southern Italy.
15886699 2005 The DNA mismatch repair gene hMSH2 is a potent coactivator of oestrogen receptor alpha.
15870899 2005 Immunohistochemical detection of hMLH1 and hMSH2 proteins in vulvar carcinoma.
15870828 2005 Hereditary nonpolyposis colorectal cancer: pitfalls in deletion screening in MSH2 and MLH1 genes.
15862756 2005 Identification of predictive factors for the occurrence of predisposing MLH1 and MSH2 germline mutations among Sardinian patients with colorectal carcinoma.
15858146 2005 Analysis of hMLH1 and hMSH2 gene dosage alterations in hereditary nonpolyposis colorectal cancer patients by novel methods.
15856462 2005 Immune responses to DNA mismatch repair enzymes hMSH2 and hPMS1 in patients with pancreatic cancer, dermatomyositis and polymyositis.
15855819 2005 Defective DNA mismatch repair in long-term (> or =3 years) survivors with pancreatic cancer.
15849733 2005 Spectrum and frequencies of mutations in MSH2 and MLH1 identified in 1,721 German families suspected of hereditary nonpolyposis colorectal cancer.
15832775 Altered expression of the DNA mismatch repair proteins hMLH1 and hMSH2 in cutaneous dysplastic nevi and malignant melanoma.
15831578 2005 Accuracy of MSI testing in predicting germline mutations of MSH2 and MLH1: a case study in Bayesian meta-analysis of diagnostic tests without a gold standard.
15816455 Correlation between hMLH1/hMSH2 and p53 protein expression in sporadic colorectal cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15808853 2005 hMutS alpha is protected from ubiquitin-proteasome-dependent degradation by atypical protein kinase C zeta phosphorylation.
15807307 2005 Immunohistochemical expression of DNA mismatch repair (MMR) system proteins (hMLH1, hMSH2) in cervical preinvasive and invasive lesions.
15786548 2005 Clinicopathological and molecular genetic analysis of HNPCC in China.
15782118 2005 BRAF-V600E is not involved in the colorectal tumorigenesis of HNPCC in patients with functional MLH1 and MSH2 genes.
15774782 2005 Psychological impact of genetic testing for hereditary nonpolyposis colorectal cancer.
15735976 2005 Expression of the hMLH1 and hMSH2 proteins in normal tissues: relationship to cancer predisposition in hereditary non-polyposis colon cancer.
15713769 2005 Conversion analysis for mutation detection in MLH1 and MSH2 in patients with colorectal cancer.
15696491 2005 [Large genomic deletions of mismatch repair genes in Chinese patients with hereditary nonpolyposis colorectal cancer].
15613860 2005 Value of immunohistochemical detection of DNA mismatch repair proteins in predicting germline mutation in hereditary colorectal neoplasms.
15613555 2004 Genetic characterization of Chinese hereditary non-polyposis colorectal cancer by DHPLC and multiplex PCR.
15596632 2004 Tobacco use and increased colorectal cancer risk in patients with hereditary nonpolyposis colorectal cancer (Lynch syndrome).
15571801 2004 Six novel heterozygous MLH1, MSH2, and MSH6 and one homozygous MLH1 germline mutations in hereditary nonpolyposis colorectal cancer.
15527911 2004 Met688Ile and Leu390Phe of the MSH2 gene are not functional mutations, but polymorphisms in Japanese individuals.
15523694 2005 Genotype phenotype correlations in Israeli colorectal cancer patients.
15520370 2004 Multiple rare variants in different genes account for multifactorial inherited susceptibility to colorectal adenomas.
15503820 Mismatch repair protein MSH2 expression and prognosis of colorectal cancer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467751 2004 Differential regulation of expression of the mammalian DNA repair genes by growth stimulation.
15467433 2004 Mismatch repair gene expression and genetic instability in testicular germ cell tumor.
15467428 2004 Alterations of p53, Bcl-2, and hMSH2 protein expression in the normal breast, benign proliferative breast disease, in situ and infiltrating ductal breast carcinomas in the upper Egypt.
15375803 Colorectal cancer prevention.
15365996 2004 Ten novel MSH2 and MLH1 germline mutations in families with HNPCC.
15365995 2004 Germline mutations in MLH1, MSH2 and MSH6 in Korean hereditary non-polyposis colorectal cancer families.
15350299 2004 Multiple epithelial and nonepithelial tumors in hereditary nonpolyposis colorectal cancer: characterization of germline and somatic mutations of the MSH2 gene and heterogeneity of replication error phenotypes.
15342696 2004 BRAF screening as a low-cost effective strategy for simplifying HNPCC genetic testing.
15340264 2004 Genotyping possible polymorphic variants of human mismatch repair genes in healthy Korean individuals and sporadic colorectal cancer patients.
15309712 2004 Clinical features and mismatch repair gene mutation screening in Chinese patients with hereditary nonpolyposis colorectal carcinoma.
15300854 2004 RNA analysis reveals splicing mutations and loss of expression defects in MLH1 and BRCA1.
15241839 2004 Psychologic distress after disclosure of genetic test results regarding hereditary nonpolyposis colorectal carcinoma.
15216397 2004 Microsatellite instability and hMLH1 and hMSH2 gene expression in Taiwanese hereditary nonpolyposis colorectal cancer.
15200905 2004 [Clinical features and hMSH2/hMLH1 germline mutation screening of Chinese hereditary nonpolyposis colorectal cancer patients].
15161053 Altered expression and new mutations in DNA mismatch repair genes MLH1 and MSH2 in melanoma brain metastases.
15105434 2004 Differential specificities and simultaneous occupancy of human MutSalpha nucleotide binding sites.
15064730 2004 The mismatch DNA repair heterodimer, hMSH2/6, regulates BLM helicase.
15063132 2004 Novel germline hMSH2 genomic deletion and somatic hMSH2 mutations in a hereditary nonpolyposis colorectal cancer family.
15062061 2004 [Clinical analysis and molecular genetic study of hereditary nonpolyposis colorectal cancer kindreds].
15046096 2004 Gene symbol: hMSH2. Disease: Hereditary nonpolyposis colorectal cancer.
15043999 2004 Degadration of mismatch repair hMutSalpha heterodimer by the ubiquitin-proteasome pathway.
15043284 2004 Acceptance of and attitude toward genetic testing for hereditary nonpolyposis colorectal cancer: a comparison of participants and nonparticipants in genetic counseling.
15042510 2004 MSH2 c.1452-1455delAATG is a founder mutation and an important cause of hereditary nonpolyposis colorectal cancer in the southern Chinese population.
15015769 2004 Increased hMSH2 protein expression in glioblastoma multiforme.
15014079 2004 Evidence for involvement of HMGB1 protein in human DNA mismatch repair.
14961575 2004 Mutation analysis of the MLH1, MSH2 and MSH6 genes in patients with double primary cancers of the colorectum and the endometrium: a population-based study in northern Sweden.
14760534 2004 Correlation between patterns of DNA mismatch repair hmlh1 and hmsh2 protein expression and progression of dysplasia in intraductal papillary mucinous neoplasms of the pancreas.
14716824 2004 Genetic detection of Chinese hereditary nonpolyposis colorectal cancer.
14714570 2003 hMLH1 and hMSH2 gene mutations are present in radial growth-phase cutaneous malignant melanoma cell lines and can be induced further by ultraviolet-B irradiation.
14706347 2004 Functional and physical interactions between ERCC1 and MSH2 complexes for resistance to cis-diamminedichloroplatinum(II) in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676842 2004 Characterization of human exonuclease 1 in complex with mismatch repair proteins, subcellular localization and association with PCNA.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
14645426 2003 Toward new strategies to select young endometrial cancer patients for mismatch repair gene mutation analysis.
14635101 2003 Genomic deletions in MSH2 or MLH1 are a frequent cause of hereditary non-polyposis colorectal cancer: identification of novel and recurrent deletions by MLPA.
14631366 2004 Microsatellite instability and expression of hMLH1 and hMSH2 proteins in ovarian endometrioid cancer.
14580774 2003 Polymorphism in the hMSH2 gene (gIVS 12-6T-->C) and risk of non-Hodgkin lymphoma in a Japanese population.
14574163 2003 Does the occurrence of certain rare cancers indicate an inherited cancer susceptibility?
14562278 2003 Possible association between tumor-suppressor gene mutations and hMSH2/hMLH1 inactivation in alveolar soft part sarcoma.
14529665 2003 Gynecologic screening in hereditary nonpolyposis colorectal cancer.
14526391 2003 Missense mutations in hMLH1 and hMSH2 are associated with exonic splicing enhancers.
14504054 2003 Microsatellite instability and mutation analysis among southern Italian patients with colorectal carcinoma: detection of different alterations accounting for MLH1 and MSH2 inactivation in familial cases.
14500385 2003 Role of MutSalpha in the recognition of iododeoxyuridine in DNA.
14499697 2003 Identification of germline MSH2 gene mutations in endometrial cancer not fulfilling the new clinical criteria for hereditary nonpolyposis colorectal cancer.
12938096 2003 Identification and characterization of genomic rearrangements of MSH2 and MLH1 in Lynch syndrome (HNPCC) by novel techniques.
12930688 2003 [Mutation analysis on MSH2 and MLH1 genes in patients of colorectal cancer at early age].
12920342 Electro-oculographic and electroretinographic studies in HNPCC gene mutation carriers.
12912950 2003 An intron splice acceptor polymorphism in hMSH2 and risk of leukemia after treatment with chemotherapeutic alkylating agents.
12817878 2003 Expression of the DNA mismatch repair proteins (hMLH1 and hMSH2) in infiltrating pancreatic cancer and its relation to some phenotypic features.
12810667 2003 MSH2-deficient human cells exhibit a defect in the accurate termination of homology-directed repair of DNA double-strand breaks.
12808326 2003 Characterization of mutator pathway in younger-age-onset colorectal adenocarcinomas.
12799449 2003 N-terminus of hMLH1 confers interaction of hMutLalpha and hMutLbeta with hMutSalpha.
12792735 Oncogenic pathway of sporadic colorectal cancer with novel germline missense mutations in the hMSH2 gene.
12754350 2003 p53, mdm2, EGFR, and msh2 expression in paired initial and recurrent glioblastoma multiforme.
12712438 2003 Differential expression of hMLH1 and hMSH2 is related to bladder cancer grade, stage and prognosis but not microsatellite instability.
12697969 2003 Microsatellite instability is often observed in esophageal carcinoma patients with allelic loss in the FHIT/FRA3B locus.
12694232 2003 Identification of a deletion in the mismatch repair gene, MSH2, using mouse-human cell hybrids monosomal for chromosome 2.
12688322 2003 Analysis of the polymorphism [gIVS12-6T > C] in the hMSH2 gene in lymphoma and leukemia.
12684691 2003 Global DNA methylation in relation to hMLH1 and hMSH2 protein immunoreactivity in sporadic human endometrial carcinomas.
12684669 2003 Alterations in PMS2, MSH2 and MLH1 expression in human prostate cancer.
12660027 2003 Three new mutations in hereditary nonpolyposis colorectal cancer (Lynch syndrome II) in Uruguay.
12658575 2003 Molecular analysis of hereditary nonpolyposis colorectal cancer in the United States: high mutation detection rate among clinically selected families and characterization of an American founder genomic deletion of the MSH2 gene.
12655568 2003 Novel MLH1 and MSH2 germline mutations in the first HNPCC families identified in Slovakia.
12655564 2003 Genetic analysis of familial colorectal cancer in Israeli Arabs.
12632492 2003 Studies on microsatellite instability in p16 gene and expression of hMSH2 mRNA in human gastric cancer tissues.
12627520 2003 Microsatellite instability and expression of MLH1 and MSH2 in carcinomas of the small intestine.
12622604 2003 Genetic counseling and testing in families with hereditary nonpolyposis colorectal cancer.
12610360 2003 The immunohistochemical detection of mismatch repair gene proteins (MLH1, MSH2, MSH6, and PMS2): practical aspects in antigen retrieval and biotin blocking protocols.
12595050 2003 A636P is associated with early-onset colon cancer in Ashkenazi Jews.
12584560 2003 Interactions of the DNA mismatch repair proteins MLH1 and MSH2 with c-MYC and MAX.
12582944 2003 Age-related expression of p53, Mdm2, EGFR and Msh2 in glioblastoma multiforme.
12549480 2003 Early onset brain tumor and lymphoma in MSH2-deficient children.
12522549 2003 Two mismatch repair gene mutations found in a colon cancer patient--which one is pathogenic?
12494471 2003 Hereditary nonpolyposis colorectal cancer: frequent occurrence of large genomic deletions in MSH2 and MLH1 genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469220 2003 Mutation analysis of K-ras and beta-catenin genes related to O6-methylguanin-DNA methyltransferase and mismatch repair protein status in human gallbladder carcinoma.
12454801 2002 The founder mutation MSH2*1906G-->C is an important cause of hereditary nonpolyposis colorectal cancer in the Ashkenazi Jewish population.
12447371 2003 The mismatch repair system is required for S-phase checkpoint activation.
12419761 2002 Mismatch repair genes hMLH1 and hMSH2 and colorectal cancer: a HuGE review.
12414623 2002 Functional alterations of human exonuclease 1 mutants identified in atypical hereditary nonpolyposis colorectal cancer syndrome.
12391284 2002 Identification of transdominant-negative genetic suppressor elements derived from hMSH2 that mediate resistance to 6-thioguanine.
12373605 2002 Genomic deletions of MSH2 and MLH1 in colorectal cancer families detected by a novel mutation detection approach.
12362047 2002 Germline MSH2 and MLH1 mutational spectrum in HNPCC families from Poland and the Baltic States.
12203789 2002 A 10-Mb paracentric inversion of chromosome arm 2p inactivates MSH2 and is responsible for hereditary nonpolyposis colorectal cancer in a North-American kindred.
12200596 2002 Impact of microsatellite testing and mismatch repair protein expression on the clinical interpretation of genetic testing in hereditary non-polyposis colorectal cancer.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12132870 2001 hMLH1 and hMSH2 mutations in families with familial clustering of gastric cancer and hereditary non-polyposis colorectal cancer.
12124176 2002 HNPCC mutations in hMSH2 result in reduced hMSH2-hMSH6 molecular switch functions.
12112654 2002 Hereditary non-polyposis colorectal cancer (HNPCC): phenotype-genotype correlation between patients with and without identified mutation.
12095971 2002 hMLH1 and hMSH2 gene mutation in Brazilian families with suspected hereditary nonpolyposis colorectal cancer.
12034830 2002 Interactions between p53, hMSH2-hMSH6 and HMG I(Y) on Holliday junctions and bulged bases.
11999575 2002 Mismatch repair gene expression in malignant lymphoproliferative disorders of B-cell origin.
11920650 2002 Prevalence of germline mutations of MLH1 and MSH2 in hereditary nonpolyposis colorectal cancer families from Spain.
11920468 2002 Cyclical change of hMSH2 protein expression in normal endometrium during the menstrual cycle and its overexpression in endometrial hyperplasia and sporadic endometrial carcinoma.
11920458 2002 Evaluation of screening strategy for detecting hereditary nonpolyposis colorectal carcinoma.
11910346 2002 Hereditary nonpolyposis colorectal cancer in young colorectal cancer patients: high-risk clinic versus population-based registry.
11890986 2002 A polymorphism in the hMSH2 gene (gIVS12-6T>C) associated with non-Hodgkin lymphomas.
11879922 2002 Mutation analysis of MLH1 and MSH2 genes performed by denaturing high-performance liquid chromatography.
11877377 2002 SMC1 is a downstream effector in the ATM/NBS1 branch of the human S-phase checkpoint.
11870161 2002 Mutations of hMLH1 and hMSH2 in patients with suspected hereditary nonpolyposis colorectal cancer: correlation with microsatellite instability and abnormalities of mismatch repair protein expression.
11859209 2002 Expression of telomerase reverse transcriptase (TERT) in malignant mesotheliomas.
11857745 2002 A modified multiplex PCR assay for detection of large deletions in MSH2 and MLH1.
11839723 2002 Pathogenicity of missense and splice site mutations in hMSH2 and hMLH1 mismatch repair genes: implications for genetic testing.
11809883 2002 hMutSalpha forms an ATP-dependent complex with hMutLalpha and hMutLbeta on DNA.
11809679 2002 A homozygous germ-line mutation in the human MSH2 gene predisposes to hematological malignancy and multiple café-au-lait spots.
11801590 2002 Human MutY homolog, a DNA glycosylase involved in base excision repair, physically and functionally interacts with mismatch repair proteins human MutS homolog 2/human MutS homolog 6.
11782355 2002 Mutational analysis of promoters of mismatch repair genes hMSH2 and hMLH1 in hereditary nonpolyposis colorectal cancer and early onset colorectal cancer patients: identification of three novel germ-line mutations in promoter of the hMSH2 gene.
11756455 2002 Activation of human MutS homologs by 8-oxo-guanine DNA damage.
11748856 2001 Eight novel germline MLH1 and MSH2 mutations in hereditary non-polyposis colorectal cancer families from Spain.
11726306 2001 Sixteen rare sequence variants of the hMLH1 and hMSH2 genes found in a cohort of 254 suspected HNPCC (hereditary non-polyposis colorectal cancer) patients: mutations or polymorphisms?
11606497 2001 The colon cancer burden of genetically defined hereditary nonpolyposis colon cancer.
11600610 2001 MSH2 mutation carriers are at higher risk of cancer than MLH1 mutation carriers: a study of hereditary nonpolyposis colorectal cancer families.
11579115 2001 Molecular screening for hereditary nonpolyposis colorectal cancer: a prospective, population-based study.
11562928 2001 Motivations and psychosocial impact of genetic testing for HNPCC.
11555625 2001 Functional analysis of human MLH1 and MSH2 missense variants and hybrid human-yeast MLH1 proteins in Saccharomyces cerevisiae.
11531323 2001 Two cases of lymphadenopathy with liver dysfunction due to Mycoplasma pneumoniae infection with mycoplasmal bacteraemia without pneumonia.
11524701 2001 The frequency of hereditary defective mismatch repair in a prospective series of unselected colorectal carcinomas.
11498787 2001 Adenosine nucleotide modulates the physical interaction between hMSH2 and BRCA1.
11474654 2001 Hereditary and somatic DNA mismatch repair gene mutations in sporadic endometrial carcinoma.
11429708 2001 HNPCC mutations in the human DNA mismatch repair gene hMLH1 influence assembly of hMutLalpha and hMLH1-hEXO1 complexes.
11427529 2001 The interaction of DNA mismatch repair proteins with human exonuclease I.
11306449 2001 Lack of MSH2 and MSH6 characterizes endometrial but not colon carcinomas in hereditary nonpolyposis colorectal cancer.
11208710 2001 Efficient detection of hereditary nonpolyposis colorectal cancer gene carriers by screening for tumor microsatellite instability before germline genetic testing.
11158177 2001 Germline mutation analysis of the transforming growth factor beta receptor type II (TGFBR2) and E-cadherin (CDH1) genes in early onset and familial colorectal cancer.
11104559 2000 Population carrier frequency of hMSH2 and hMLH1 mutations.
10978353 2000 Recurrent germline mutation in MSH2 arises frequently de novo.
10874318 2000 Novel germline mutation (300-305delAGTTGA) in the human MSH2 gene in hereditary non-polyposis colorectal cancer (HNPCC).
10856833 2000 Identification of factors interacting with hMSH2 in the fetal liver utilizing the yeast two-hybrid system. In vivo interaction through the C-terminal domains of hEXO1 and hMSH2 and comparative expression analysis.
10829038 2000 Population-based molecular detection of hereditary nonpolyposis colorectal cancer.
10783165 2000 BASC, a super complex of BRCA1-associated proteins involved in the recognition and repair of aberrant DNA structures.
10777691 2000 Enhanced detection of deleterious and other germline mutations of hMSH2 and hMLH1 in Japanese hereditary nonpolyposis colorectal cancer kindreds.
10713887 2000 Detection of mutations in mismatch repair genes in Portuguese families with hereditary non-polyposis colorectal cancer (HNPCC) by a multi-method approach.
10693791 2000 Conversion of diploidy to haploidy.
10660545 2000 The role of mismatched nucleotides in activating the hMSH2-hMSH6 molecular switch.
10612836 2000 Four novel MSH2 / MLH1 gene mutations in portuguese HNPCC families.
10573010 Assessment of pathogenicity criteria for constitutional missense mutations of the hereditary nonpolyposis colorectal cancer genes MLH1 and MSH2.
10528862 1999 A missense mutation in both hMSH2 and APC in an Ashkenazi Jewish HNPCC kindred: implications for clinical screening.
10469597 1999 Mutator phenotypes of common polymorphisms and missense mutations in MSH2.
10386556 1999 Novel hMLH1 and hMSH2 germline mutations in African Americans with colorectal cancer.
10375096 1999 Influence of selection criteria on mutation detection in patients with hereditary nonpolyposis colorectal cancer.
10078208 1999 hMSH2-hMSH6 forms a hydrolysis-independent sliding clamp on mismatched DNA.
10051005 1999 A common MSH2 mutation in English and North American HNPCC families: origin, phenotypic expression, and sex specific differences in colorectal cancer.
10023327 1998 MSH2 codon 322 Gly to Asp seems not to confer an increased risk for colorectal cancer susceptibility.
9889267 1999 Functional analysis of human MutSalpha and MutSbeta complexes in yeast.
9843200 1998 MSH2 genomic deletions are a frequent cause of HNPCC.
9822680 1998 Nucleotide-promoted release of hMutSalpha from heteroduplex DNA is consistent with an ATP-dependent translocation mechanism.
9822679 1998 DNA-dependent activation of the hMutSalpha ATPase.
9788596 1998 Human exonuclease I interacts with the mismatch repair protein hMSH2.
9777949 1998 Microsatellite instability and mutation of DNA mismatch repair genes in gliomas.
9774676 1998 Interactions of human hMSH2 with hMSH3 and hMSH2 with hMSH6: examination of mutations found in hereditary nonpolyposis colorectal cancer.
9740671 1998 Cloning, structural characterization, and chromosomal localization of the human orthologue of Saccharomyces cerevisiae MSH5 gene.
9718327 1998 Systematic analysis of hMSH2 and hMLH1 in young colon cancer patients and controls.
9709044 1998 Clinical findings with implications for genetic testing in families with clustering of colorectal cancer.
9621522 1998 Novel germline mutations of hMSH2 in a patient with hereditary nonpolyposis colorectal cancer (HNPCC) and in a patient with six primary cancers.
9564049 1998 hMSH2 and hMSH6 play distinct roles in mismatch binding and contribute differently to the ATPase activity of hMutSalpha.
9559627 1998 Germline mutations of hMLH1 and hMSH2 genes in patients with suspected hereditary nonpolyposis colorectal cancer and sporadic early-onset colorectal cancer.
9490293 1998 Characterization of MLH1 and MSH2 alternative splicing and its relevance to molecular testing of colorectal cancer susceptibility.
9428522 1997 The human mismatch recognition complex hMSH2-hMSH6 functions as a novel molecular switch.
9419403 1997 Identification of concurrent germ-line mutations in hMSH2 and/or hMLH1 in Japanese hereditary nonpolyposis colorectal cancer kindreds.
9311737 1997 Hereditary nonpolyposis colorectal cancer families not complying with the Amsterdam criteria show extremely low frequency of mismatch-repair-gene mutations.
9298827 1997 Hereditary nonpolyposis colorectal cancer (HNPCC): eight novel germline mutations in hMSH2 or hMLH1 genes.
9259192 1997 Molecular basis of HNPCC: mutations of MMR genes.
9240418 1997 Frequent somatic mutations of hMSH3 with reference to microsatellite instability in hereditary nonpolyposis colorectal cancers.
9217825 1997 Muir-Torre syndrome: clinical features and molecular genetic analysis.
9207118 1997 Identification and characterization of Saccharomyces cerevisiae EXO1, a gene encoding an exonuclease that interacts with MSH2.
9111864 1997 Mutations predisposing to hereditary nonpolyposis colorectal cancer.
9087566 1997 MSH2 and MLH1 mutations in sporadic replication error-positive colorectal carcinoma as assessed by two-dimensional DNA electrophoresis.
9060003 1997 Microsatellite instability in human solid tumors.
9048925 1997 Use of SSCP analysis to identify germline mutations in HNPCC families fulfilling the Amsterdam criteria.
9024626 1997 MutS homologs in mammalian cells.
8993976 1997 Characterization of MSH2 and MLH1 mutations in Italian families with hereditary nonpolyposis colorectal cancer.
8942985 1996 hMSH2 forms specific mispair-binding complexes with hMSH3 and hMSH6.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8872463 1996 Microsatellite instability and mutation analysis of hMSH2 and hMLH1 in patients with sporadic, familial and hereditary colorectal cancer.
8858149 1996 Requirement for PCNA in DNA mismatch repair at a step preceding DNA resynthesis.
8797773 1996 Germline mutations of hMLH1 and hMSH2 genes in Korean hereditary nonpolyposis colorectal cancer.
8769132 1996 A carboxy terminal domain of the hMSH-2 gene product is sufficient for binding specific mismatched oligonucleotides.
8723682 1996 Mutation of the hMSH2 gene in two families with hereditary nonpolyposis colorectal cancer.
8700523 1996 Microsatellite instability and the role of hMSH2 in sporadic colorectalcancer.
8690195 1996 Molecular nature of colon tumors in hereditary nonpolyposis colon cancer, familial polyposis, and sporadic colon cancer.
8566964 1996 CpG dinucleotides in the hMSH2 and hMLH1 genes are hotspots for HNPCC mutations.
8484120 1993 Genetic mapping of a locus predisposing to human colorectal cancer.
8261515 1993 Mutations of a mutS homolog in hereditary nonpolyposis colorectal cancer.
8252616 1993 The human mutator gene homolog MSH2 and its association with hereditary nonpolyposis colon cancer.
8168125 1994 DNA chaperones: a solution to a persistence problem?
8156592 1994 The human mutator gene homolog MSH2 and its association with hereditary nonpolyposis colon cancer.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8062247 1994 hMSH2 mutations in hereditary nonpolyposis colorectal cancer kindreds.
8036718 1994 Colon cancer and DNA repair: have mismatches met their match?
7973733 1994 Binding of mismatched microsatellite DNA sequences by the human MSH2 protein.
7923193 1994 Purified human MSH2 protein binds to DNA containing mismatched nucleotides.
7874129 1994 Mutational analysis of the hMSH2 gene reveals a three base pair deletion in a family predisposed to colorectal cancer development.
7726159 1995 Seven new mutations in hMSH2, an HNPCC gene, identified by denaturing gradient-gel electrophoresis.
7713503 1994 Structure of the human MSH2 locus and analysis of two Muir-Torre kindreds for msh2 mutations.
7604264 1995 Isolation of an hMSH2-p160 heterodimer that restores DNA mismatch repair to tumor cells.
7585562 1995 Differential cellular expression of the human MSH2 repair enzyme in small and large intestine.
7585546 1995 Simultaneous amplification of four DNA repair genes and beta-actin in human lymphocytes by multiplex reverse transcriptase-PCR.
4016686 1985 Hereditary nonpolyposis colorectal cancer (Lynch syndromes I and II). II. Biomarker studies.