Property Summary

NCBI Gene PubMed Count 2
PubMed Score 12.61
PubTator Score 1.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
psoriasis 6694 3.1e-02

Gene RIF (1)

AA Sequence

MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSPCPAVAGLPCE      1 - 70
HGGASSGGSEGCSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTL     71 - 140
ADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNRGREPRAQSA                     141 - 193
//

Text Mined References (3)

PMID Year Title