Property Summary

NCBI Gene PubMed Count 2
PubMed Score 11.61
PubTator Score 1.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
psoriasis 6685 3.1e-02

Gene RIF (1)

PMID Text
10837126 Described the cloning, expression and function of the mouse and frog mesogenin 1.

AA Sequence

MDNLRETFLSLEDGLGSSDSPGLLSSWDWKDRAGPFELNQASPSQSLSPAPSLESYSSSPCPAVAGLPCE      1 - 70
HGGASSGGSEGCSVGGASGLVEVDYNMLAFQPTHLQGGGGPKAQKGTKVRMSVQRRRKASEREKLRMRTL     71 - 140
ADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNRGREPRAQSA                     141 - 193
//

Text Mined References (3)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11181995 2001 The sequence of the human genome.
10837126 2000 The bHLH class protein pMesogenin1 can specify paraxial mesoderm phenotypes.